DENND2A Antibody - N-terminal region (ARP70137_P050)

Catalog No: ARP70137_P050

Host: Rabbit
Target Name: DENND2A
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DENND2A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 91%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: DRSLENVYRGSEGSPTKPFINPLPKPRRTFKHAGEGDKDGKPGIGFRKEK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DENND2A (ARP70137_P050) antibody is Catalog # AAP70137

Target Info

• Gene Symbol: DENND2A
• Alias Symbols: FAM31D, KIAA1277
• NCBI Gene Id: 27147
• Protein Name: DENN domain-containing protein 2A
• Description of Target: DENND2A is a guanine nucleotide exchange factor (GEF) which may activate RAB9A and RAB9B. It promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form and may play a role in late endosomes back to trans-Golgi network/TGN transport.
• Uniprot ID: Q9ULE3
• Protein Accession #: NP_056504
• Nucleotide Accession #: NM_015689
• Protein Size (# AA): 1009
• Molecular Weight: 113kDa
• Protein Interactions: Dlg4;