Catalog No: OPCA04633
Price: $0.00
SKU
OPCA04633
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
DELTA-ACTITOXIN-AVD1C Recombinant Protein (Mediterranean snakelocks sea anemone) (OPCA04633)
Datasheets/Manuals | Printable datasheet for DELTA-ACTITOXIN-AVD1C Recombinant Protein (Mediterranean snakelocks sea anemone) (OPCA04633) (OPCA04633) |
---|
Predicted Species Reactivity | Anemonia sulcata|Snake-locks Sea Anemone |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Anemonia sulcata (Mediterranean snakelocks sea anemone) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ |
Protein Sequence | GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 1-47 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Anemonia sulcata toxins modify activation and inactivation of Na+ currents in a crayfish neurone.Hartung K., Rathmayer W.Pflugers Arch. 404:119-125(1985) |
Alias Symbols | Anemonia sulcata toxin 2;ATX-II;Neurotoxin 2;Toxin II. |
---|---|
Protein Name | Delta-actitoxin-Avd1c |
Description of Target | Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC(50)=6.01 nM) and Nav1.2/SCN2A (EC(50)=7.88 nM) (PubMed:15169781). It has also great activity on Nav1.5/SCN5A (EC(50)=49.05 nM), Nav1.4/SCN4A (EC(50)=109.49 nM) and Nav1.6/SCN8A (EC(50)=about 180 nM) and is less potent on Nav1.3/SCN3A (EC(50)=759.22 nM) (when measured as the increase in the slow component) (PubMed:15169781). |
Uniprot ID | P01528 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 6.9 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review