DELTA-ACTITOXIN-AVD1C Recombinant Protein (Mediterranean snakelocks sea anemone) (OPCA04633)

Catalog No: OPCA04633

Product Info

• Predicted Species Reactivity: Anemonia sulcata|Snake-locks Sea Anemone
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Anemonia sulcata (Mediterranean snakelocks sea anemone)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
• Protein Sequence: GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 1-47 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Anemonia sulcata toxins modify activation and inactivation of Na+ currents in a crayfish neurone.Hartung K., Rathmayer W.Pflugers Arch. 404:119-125(1985)
• Alias Symbols: Anemonia sulcata toxin 2;ATX-II;Neurotoxin 2;Toxin II.
• Protein Name: Delta-actitoxin-Avd1c
• Description of Target: Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC(50)=6.01 nM) and Nav1.2/SCN2A (EC(50)=7.88 nM) (PubMed:15169781). It has also great activity on Nav1.5/SCN5A (EC(50)=49.05 nM), Nav1.4/SCN4A (EC(50)=109.49 nM) and Nav1.6/SCN8A (EC(50)=about 180 nM) and is less potent on Nav1.3/SCN3A (EC(50)=759.22 nM) (when measured as the increase in the slow component) (PubMed:15169781).
• Uniprot ID: P01528
• Protein Size (# AA): Recombinant
• Molecular Weight: 6.9 kDa