Size:100 ul
$229.00
In stock
SKU
P100637_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100637_T100-FITC Conjugated

P100637_T100-HRP Conjugated

P100637_T100-Biotin Conjugated

DEK Antibody - N-terminal region (P100637_T100)

Catalog#: P100637_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-136222 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DEK
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 78%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Rabbit: 85%; Rat: 85%
Complete computational species homology data Anti-DEK (P100637_T100)
Peptide Sequence Synthetic peptide located within the following region: AAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DEK (P100637_T100) antibody is Catalog # AAP30905 (Previous Catalog # AAPP01629)
Datasheets/Manuals Printable datasheet for anti-DEK (P100637_T100) antibody
Target Reference Orlic,M., et al., (2006) Genes Chromosomes Cancer 45 (1), 72-82
Publications

Wang, N. et al. Down-regulation of HtrA1 activates the epithelial-mesenchymal transition and ATM DNA damage response pathways. PLoS One 7, e39446 (2012). WB, Cow, Guinea Pig, Horse, Human, Rabbit, Rat 22761798

Gene Symbol DEK
Official Gene Full Name DEK oncogene
Alias Symbols D6S231E
NCBI Gene Id 7913
Protein Name Protein DEK
Description of Target DEK was first identified in a fusion with the CAN nucleoporin protein in a specific subtype of acute myelogenous leukemia. DEK has also been shown to be an autoantigen in patients with pauciarticular onset juvenile rheumatoid arthritis. Further, the last 65 amino acids of DEK can partially reverse the mutation-prone phenotype of cells from patients with ataxia-telangiectasia
Swissprot Id P35659
Protein Accession # NP_003463
Nucleotide Accession # NM_003472
Protein Size (# AA) 375
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DEK.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DEK.
Protein Interactions CUL3; SPOP; UBC; EED; IRF2BP2; GANAB; PTPN12; CSNK2A2; CSNK2A1; TP53BP1; ESR1; VTN; S100A9; RPL37A; DHX15; FTSJ3; WIBG; TMED9; EXOSC2; UTP14A; THRAP3; CAND1; COPS5; CDK2; YWHAZ; Cebpb; ELAVL1; SUMO1; SUMO2; RAD21; HDGF; KAT2B; EP300; CREBBP; HIST1H4A; HDA
Write Your Own Review
You're reviewing:DEK Antibody - N-terminal region (P100637_T100)
Your Rating