Search Antibody, Protein, and ELISA Kit Solutions

DEK Antibody - N-terminal region (P100637_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

P100637_T100-FITC Conjugated

P100637_T100-HRP Conjugated

P100637_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
DEK oncogene
NCBI Gene Id:
Protein Name:
Protein DEK
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-136222 from Santa Cruz Biotechnology.
Description of Target:
DEK was first identified in a fusion with the CAN nucleoporin protein in a specific subtype of acute myelogenous leukemia. DEK has also been shown to be an autoantigen in patients with pauciarticular onset juvenile rheumatoid arthritis. Further, the last 65 amino acids of DEK can partially reverse the mutation-prone phenotype of cells from patients with ataxia-telangiectasia
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DEK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DEK.
The immunogen is a synthetic peptide directed towards the N terminal region of human DEK
Predicted Homology Based on Immunogen Sequence:
Cow: 78%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Rabbit: 85%; Rat: 85%
Complete computational species homology data:
Anti-DEK (P100637_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DEK (P100637_T100) antibody is Catalog # AAP30905 (Previous Catalog # AAPP01629)
Printable datasheet for anti-DEK (P100637_T100) antibody
Target Reference:
Orlic,M., et al., (2006) Genes Chromosomes Cancer 45 (1), 72-82

Wang, N. et al. Down-regulation of HtrA1 activates the epithelial-mesenchymal transition and ATM DNA damage response pathways. PLoS One 7, e39446 (2012). WB, Cow, Guinea Pig, Horse, Human, Rabbit, Rat 22761798

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...