- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-DEK (P100637_T100-FITC) antibody |
---|
Predicted Species Reactivity | Human, Rat, Cow, Guinea Pig, Horse, Rabbit |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DEK |
Predicted Homology Based on Immunogen Sequence | Cow: 78%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Rabbit: 85%; Rat: 85% |
Peptide Sequence | Synthetic peptide located within the following region: AAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEG |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-DEK (P100637_T100-FITC) antibody is Catalog # AAP30905 (Previous Catalog # AAPP01629) |
Reference | Orlic,M., et al., (2006) Genes Chromosomes Cancer 45 (1), 72-82 |
Publications | Wang, N. et al. Down-regulation of HtrA1 activates the epithelial-mesenchymal transition and ATM DNA damage response pathways. PLoS One 7, e39446 (2012). WB, Bovine, Guinea pig, Horse, Human, Pig, Rabbit, Rat 22761798 |
Gene Symbol | DEK |
---|---|
Gene Full Name | DEK oncogene |
Alias Symbols | D6S231E |
NCBI Gene Id | 7913 |
Protein Name | Protein DEK |
Description of Target | DEK was first identified in a fusion with the CAN nucleoporin protein in a specific subtype of acute myelogenous leukemia. DEK has also been shown to be an autoantigen in patients with pauciarticular onset juvenile rheumatoid arthritis. Further, the last 65 amino acids of DEK can partially reverse the mutation-prone phenotype of cells from patients with ataxia-telangiectasia |
Uniprot ID | P35659 |
Protein Accession # | NP_003463 |
Nucleotide Accession # | NM_003472 |
Protein Size (# AA) | 375 |
Molecular Weight | 43kDa |
Protein Interactions | CUL3; SPOP; UBC; EED; IRF2BP2; GANAB; PTPN12; CSNK2A2; CSNK2A1; TP53BP1; ESR1; VTN; S100A9; RPL37A; DHX15; FTSJ3; WIBG; TMED9; EXOSC2; UTP14A; THRAP3; CAND1; COPS5; CDK2; YWHAZ; Cebpb; ELAVL1; SUMO1; SUMO2; RAD21; HDGF; KAT2B; EP300; CREBBP; HIST1H4A; HDA |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "DEK Antibody - N-terminal region : FITC (P100637_T100-FITC)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Rat, Cow, Guinea Pig, Horse, Rabbit".
-
How long will it take to receive "DEK Antibody - N-terminal region : FITC (P100637_T100-FITC)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "DEK Antibody - N-terminal region : FITC (P100637_T100-FITC)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "DEK Antibody - N-terminal region : FITC (P100637_T100-FITC)"?
This target may also be called "D6S231E" in publications.
-
What is the shipping cost for "DEK Antibody - N-terminal region : FITC (P100637_T100-FITC)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "DEK Antibody - N-terminal region : FITC (P100637_T100-FITC)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "DEK Antibody - N-terminal region : FITC (P100637_T100-FITC)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "43kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "DEK Antibody - N-terminal region : FITC (P100637_T100-FITC)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "DEK"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "DEK"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "DEK"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "DEK"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "DEK"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "DEK"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.