Catalog No: P100602_P050-FITC
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DEK Antibody - middle region : FITC (P100602_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-DEK (P100602_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC: Fluorescein Isothiocyanate
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DEK
Predicted Homology Based on Immunogen SequenceCow: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 78%; Rabbit: 85%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: ELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKEL
Concentration0.5 mg/ml
Blocking PeptideFor anti-DEK (P100602_P050-FITC) antibody is Catalog # AAP30906 (Previous Catalog # AAPP01630)
ReferenceWu,Q., (2008) Pathol. Int. 58 (6), 378-382
Gene SymbolDEK
Gene Full NameDEK oncogene
Alias SymbolsD6S231E
NCBI Gene Id7913
Protein NameProtein DEK
Description of TargetDEK is a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene, and the presence of antibodies against this protein are all associated with various diseases. Two transcript variants encoding different isoforms have been found for this gene.This gene encodes a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene and the presence of antibodies against this protein are all associated with various diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP35659
Protein Accession #NP_003463
Nucleotide Accession #NM_003472
Protein Size (# AA)375
Molecular Weight43kDa
  1. What is the species homology for "DEK Antibody - middle region : FITC (P100602_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "DEK Antibody - middle region : FITC (P100602_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DEK Antibody - middle region : FITC (P100602_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DEK Antibody - middle region : FITC (P100602_P050-FITC)"?

    This target may also be called "D6S231E" in publications.

  5. What is the shipping cost for "DEK Antibody - middle region : FITC (P100602_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DEK Antibody - middle region : FITC (P100602_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DEK Antibody - middle region : FITC (P100602_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DEK Antibody - middle region : FITC (P100602_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DEK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DEK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DEK"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DEK"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DEK"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DEK"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DEK Antibody - middle region : FITC (P100602_P050-FITC)
Your Rating
We found other products you might like!