Search Antibody, Protein, and ELISA Kit Solutions

DEGS1 Antibody - N-terminal region (ARP45501_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45501_P050-FITC Conjugated

ARP45501_P050-HRP Conjugated

ARP45501_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Delta(4)-desaturase, sphingolipid 1
NCBI Gene Id:
Protein Name:
Sphingolipid delta(4)-desaturase DES1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DEGS, DES1, Des-1, FADS7, MGC5079, MIG15, MLD, DEGS-1
Replacement Item:
This antibody may replace item sc-162734 from Santa Cruz Biotechnology.
Description of Target:
DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DEGS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DEGS1.
The immunogen is a synthetic peptide directed towards the N terminal region of human DEGS1
Predicted Species Reactivity:
Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 93%
Complete computational species homology data:
Anti-DEGS1 (ARP45501_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DEGS1 (ARP45501_P050) antibody is Catalog # AAP45501 (Previous Catalog # AAPP26566)
Printable datasheet for anti-DEGS1 (ARP45501_P050) antibody
Target Reference:
Kraveka,J.M., (2007) J. Biol. Chem. 282 (23), 16718-16728

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...