Catalog No: OPCA330870
Price: $0.00
SKU
OPCA330870
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ DEF6 Recombinant Protein (Human) (OPCA330870)
Datasheets/Manuals | Printable datasheet for OPCA330870 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Additional Information | For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request. |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTANRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEEAARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTRLLEEEEEKLKQLMQLKEEQERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGGDEAPAPASTPQEDKLDPAPEN |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 1-631 |
Gene Full Name | DEF6, guanine nucleotide exchange factor |
---|---|
Alias Symbols | IBP, SLAT, SWAP70L |
NCBI Gene Id | 50619 |
Protein Name | differentially expressed in FDCP 6 homolog |
Description of Target | DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 [PubMed 12923183]).[supplied by OMIM, Mar 2008] |
Uniprot ID | Q9H4E7 |
Protein Accession # | NP_071330.3 |
Nucleotide Accession # | NM_022047.3 |
Protein Size (# AA) | 631 |
Write Your Own Review