DEDD2 Antibody - middle region (ARP52558_P050)

Catalog No: ARP52558_P050

WB Suggested Anti-DEDD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DEDD2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PQQQSEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DEDD2 (ARP52558_P050) antibody is Catalog # AAP52558 (Previous Catalog # AAPP42605)

Target Info

• Gene Symbol: DEDD2
• Gene Full Name: Death effector domain containing 2
• Alias Symbols: FLAME3, FLAME-3
• NCBI Gene Id: 162989
• Protein Name: DNA-binding death effector domain-containing protein 2
• Description of Target: DEDD2 may play a critical role in death receptor-induced apoptosis and may target CASP8 and CASP10 to the nucleus. DEDD2 may regulate degradation of intermediate filaments during apoptosis. DEDD2 may play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3.
• Uniprot ID: Q8WXF8
• Protein Accession #: NP_579874
• Nucleotide Accession #: NM_133328
• Protein Size (# AA): 326
• Molecular Weight: 36
• Protein Interactions: CDCA7L; ATG16L1; CDK6; RBFOX2; NR2E3; HNRNPAB; RHOXF2; GTF3C3; DEDD2; DEDD; CFLAR; CASP8; CASP10;