Search Antibody, Protein, and ELISA Kit Solutions

DEDD Antibody - middle region : FITC (ARP73942_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73942_P050 Unconjugated

ARP73942_P050-HRP Conjugated

ARP73942_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-119731 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that contains a death effector domain (DED). DED is a protein-protein interaction domain shared by adaptors, regulators and executors of the programmed cell death pathway. Overexpression of this gene was shown to induce weak apoptosis. Upon stimulation, this protein was found to translocate from cytoplasm to nucleus and colocalize with UBTF, a basal factor required for RNA polymerase I transcription, in the nucleolus. At least three transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DEDD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DEDD.
The immunogen is a synthetic peptide directed towards the middle region of Human DEDD
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: PTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DEDD (ARP73942_P050-FITC) antibody is Catalog # AAP73942
Printable datasheet for anti-DEDD (ARP73942_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...