Search Antibody, Protein, and ELISA Kit Solutions

DDX60L Antibody - N-terminal region (ARP68258_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP68258_P050-FITC Conjugated

ARP68258_P050-HRP Conjugated

ARP68258_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
DDX60L
NCBI Gene Id:
91351
Protein Name:
Probable ATP-dependent RNA helicase DDX60-like
Swissprot Id:
Q5H9U9
Protein Accession #:
NP_001012985
Nucleotide Accession #:
NM_001012967
Alias Symbols:
-
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
1706
Molecular Weight:
187kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DDX60L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DDX60L.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DDX60L
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Horse: 77%; Human: 100%
Peptide Sequence:
Synthetic peptide located within the following region: YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKW
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-DDX60L (ARP68258_P050) antibody is Catalog # AAP68258
Datasheets/Manuals:
Printable datasheet for anti-DDX60L (ARP68258_P050) antibody
Publications:

Grünvogel, O; Esser-Nobis, K; Reustle, A; Schult, P; Müller, B; Metz, P; Trippler, M; Windisch, MP; Frese, M; Binder, M; Fackler, O; Bartenschlager, R; Ruggieri, A; Lohmann, V; DDX60L Is an Interferon-Stimulated Gene Product Restricting Hepatitis C Virus Replication in Cell Culture. 89, 10548-68 (2015). WB, Horse, Human 26269178

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...