Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP68258_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP68258_P050-FITC Conjugated

ARP68258_P050-HRP Conjugated

ARP68258_P050-Biotin Conjugated

DDX60L Antibody - N-terminal region (ARP68258_P050)

Catalog#: ARP68258_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Horse, Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human DDX60L
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Horse: 77%; Human: 100%
Peptide Sequence Synthetic peptide located within the following region: YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKW
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DDX60L (ARP68258_P050) antibody is Catalog # AAP68258
Datasheets/Manuals Printable datasheet for anti-DDX60L (ARP68258_P050) antibody
Publications

Grünvogel, O; Esser-Nobis, K; Reustle, A; Schult, P; Müller, B; Metz, P; Trippler, M; Windisch, MP; Frese, M; Binder, M; Fackler, O; Bartenschlager, R; Ruggieri, A; Lohmann, V; DDX60L Is an Interferon-Stimulated Gene Product Restricting Hepatitis C Virus Replication in Cell Culture. 89, 10548-68 (2015). WB, Horse, Human 26269178

Gene Symbol DDX60L
Alias Symbols -
NCBI Gene Id 91351
Protein Name Probable ATP-dependent RNA helicase DDX60-like
Description of Target The function of this protein remains unknown.
Swissprot Id Q5H9U9
Protein Accession # NP_001012985
Nucleotide Accession # NM_001012967
Protein Size (# AA) 1706
Molecular Weight 187kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DDX60L.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DDX60L.
Protein Interactions UBC;
Write Your Own Review
You're reviewing:DDX60L Antibody - N-terminal region (ARP68258_P050)
Your Rating