Catalog No: ARP36365_T100
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DDX5 (ARP36365_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human DDX5
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY
Concentration1.0 mg/ml
Blocking PeptideFor anti-DDX5 (ARP36365_T100) antibody is Catalog # AAP36365 (Previous Catalog # AAPP08424)
Sample Type Confirmation

DDX5 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceGuil,S., et al., (2003) Mol. Cell. Biol. 23 (8), 2927-2941

Laux, A. et al. Localization of endogenous morphine-like compounds in the mouse spinal cord. J. Comp. Neurol. 520, 1547-61 (2012). 22174317

The zebrafish miR-462/miR-731 cluster is induced under hypoxic stress via hypoxia-inducible factor 1a and functions in cellular adaptations. FASEB J. 29, 4901-13 (2015). 26265472

Gene SymbolDDX5
Gene Full NameDEAD (Asp-Glu-Ala-Asp) box helicase 5
Alias Symbolsp68, HLR1, G17P1, HUMP68
NCBI Gene Id1655
Protein NameProbable ATP-dependent RNA helicase DDX5
Description of TargetDEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.
Uniprot IDP17844
Protein Accession #NP_004387
Nucleotide Accession #NM_004396
Protein Size (# AA)614
Molecular Weight68kDa
  1. What is the species homology for "DDX5 Antibody - C-terminal region (ARP36365_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "DDX5 Antibody - C-terminal region (ARP36365_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DDX5 Antibody - C-terminal region (ARP36365_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DDX5 Antibody - C-terminal region (ARP36365_T100)"?

    This target may also be called "p68, HLR1, G17P1, HUMP68" in publications.

  5. What is the shipping cost for "DDX5 Antibody - C-terminal region (ARP36365_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DDX5 Antibody - C-terminal region (ARP36365_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DDX5 Antibody - C-terminal region (ARP36365_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "68kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DDX5 Antibody - C-terminal region (ARP36365_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DDX5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DDX5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DDX5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DDX5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DDX5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DDX5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DDX5 Antibody - C-terminal region (ARP36365_T100)
Your Rating
We found other products you might like!