Search Antibody, Protein, and ELISA Kit Solutions

DDX5 Antibody - C-terminal region (ARP36365_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36365_T100-FITC Conjugated

ARP36365_T100-HRP Conjugated

ARP36365_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
DEAD (Asp-Glu-Ala-Asp) box helicase 5
NCBI Gene Id:
Protein Name:
Probable ATP-dependent RNA helicase DDX5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
p68, HLR1, G17P1, HUMP68
Replacement Item:
This antibody may replace item sc-175254 from Santa Cruz Biotechnology.
Description of Target:
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DDX5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DDX5.
The immunogen is a synthetic peptide directed towards the C terminal region of human DDX5
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-DDX5 (ARP36365_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DDX5 (ARP36365_T100) antibody is Catalog # AAP36365 (Previous Catalog # AAPP08424)
Printable datasheet for anti-DDX5 (ARP36365_T100) antibody
Sample Type Confirmation:

DDX5 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Guil,S., et al., (2003) Mol. Cell. Biol. 23 (8), 2927-2941

Huang, CX; Chen, N; Wu, XJ; Huang, CH; He, Y; Tang, R; Wang, WM; Wang, HL; The zebrafish miR-462/miR-731 cluster is induced under hypoxic stress via hypoxia-inducible factor 1α and functions in cellular adaptations. 29, 4901-13 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26265472

Laux, A. et al. Localization of endogenous morphine-like compounds in the mouse spinal cord. J. Comp. Neurol. 520, 1547-61 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22174317

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...