Size:100 ul
$229.00
In stock
SKU
ARP36365_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36365_T100-FITC Conjugated

ARP36365_T100-HRP Conjugated

ARP36365_T100-Biotin Conjugated

DDX5 Antibody - C-terminal region (ARP36365_T100)

Catalog#: ARP36365_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-175254 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DDX5
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-DDX5 (ARP36365_T100)
Peptide Sequence Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DDX5 (ARP36365_T100) antibody is Catalog # AAP36365 (Previous Catalog # AAPP08424)
Datasheets/Manuals Printable datasheet for anti-DDX5 (ARP36365_T100) antibody
Sample Type Confirmation

DDX5 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Guil,S., et al., (2003) Mol. Cell. Biol. 23 (8), 2927-2941
Publications

Huang, CX; Chen, N; Wu, XJ; Huang, CH; He, Y; Tang, R; Wang, WM; Wang, HL; The zebrafish miR-462/miR-731 cluster is induced under hypoxic stress via hypoxia-inducible factor 1α and functions in cellular adaptations. 29, 4901-13 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26265472

Laux, A. et al. Localization of endogenous morphine-like compounds in the mouse spinal cord. J. Comp. Neurol. 520, 1547-61 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22174317

Gene Symbol DDX5
Official Gene Full Name DEAD (Asp-Glu-Ala-Asp) box helicase 5
Alias Symbols p68, HLR1, G17P1, HUMP68
NCBI Gene Id 1655
Protein Name Probable ATP-dependent RNA helicase DDX5
Description of Target DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.
Swissprot Id P17844
Protein Accession # NP_004387
Nucleotide Accession # NM_004396
Protein Size (# AA) 614
Molecular Weight 68kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DDX5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DDX5.
Protein Interactions FUS; ESR1; DROSHA; MAPKAPK2; UBC; TP53; TUBGCP3; AURKB; SPRTN; AURKA; SUMO2; SUMO3; MDM2; CEP250; STAU1; RPA3; RPA2; RPA1; EED; EZH2; RNF2; SUZ12; rev; DDX17; PABPC4; PRPSAP1; PIN1; LRSAM1; FKBP10; ERO1L; DBNL; WDR4; PARK2; FBXO6; MAPK10; SP1; TARDBP; UBD
Write Your Own Review
You're reviewing:DDX5 Antibody - C-terminal region (ARP36365_T100)
Your Rating