Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DDX5 antibody - C-terminal region (ARP36365_T100)

100 ul
$229.00
In Stock

Conjugation Options

ARP36365_T100-FITC Conjugated

ARP36365_T100-HRP Conjugated

ARP36365_T100-Biotin Conjugated

Gene Symbol:
DDX5
NCBI Gene Id:
1655
Official Gene Full Name:
DEAD (Asp-Glu-Ala-Asp) box helicase 5
Protein Name:
Probable ATP-dependent RNA helicase DDX5
Swissprot Id:
P17844
Protein Accession #:
NP_004387
Nucleotide Accession #:
NM_004396
Alias Symbols:
p68, HLR1, G17P1, HUMP68
Replacement Item:
This antibody may replace item sc-175254 from Santa Cruz Biotechnology.
Description of Target:
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.
Protein Size (# AA):
614
Molecular Weight:
68kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DDX5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DDX5.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human DDX5
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-DDX5 (ARP36365_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FUS; ESR1; DROSHA; MAPKAPK2; UBC; TP53; TUBGCP3; AURKB; SPRTN; AURKA; SUMO2; SUMO3; MDM2; CEP250; STAU1; RPA3; RPA2; RPA1; EED; EZH2; RNF2; SUZ12; rev; DDX17; PABPC4; PRPSAP1; PIN1; LRSAM1; FKBP10; ERO1L; DBNL; WDR4; PARK2; FBXO6; MAPK10; SP1; TARDBP; UBD
Blocking Peptide:
For anti-DDX5 (ARP36365_T100) antibody is Catalog # AAP36365 (Previous Catalog # AAPP08424)
Datasheets/Manuals:
Printable datasheet for anti-DDX5 (ARP36365_T100) antibody
Sample Type Confirmation:

DDX5 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Guil,S., et al., (2003) Mol. Cell. Biol. 23 (8), 2927-2941
Publications:

Laux, A. et al. Localization of endogenous morphine-like compounds in the mouse spinal cord. J. Comp. Neurol. 520, 1547-61 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22174317

Huang, CX; Chen, N; Wu, XJ; Huang, CH; He, Y; Tang, R; Wang, WM; Wang, HL; The zebrafish miR-462/miR-731 cluster is induced under hypoxic stress via hypoxia-inducible factor 1α and functions in cellular adaptations. 29, 4901-13 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26265472

Tell us what you think about this item!

Write A Review
    Please, wait...