DDX46 Antibody - middle region (ARP36424_P050)

Catalog No: ARP36424_P050

WB Suggested Anti-DDX46 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysateDDX46 is supported by BioGPS gene expression data to be expressed in MCF7

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDX46
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DDX46 (ARP36424_P050) antibody is Catalog # AAP36424 (Previous Catalog # AAPS07109)
• Sample Type Confirmation:

  DDX46 is supported by BioGPS gene expression data to be expressed in MCF7

• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: DDX46
• Gene Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
• Alias Symbols: Prp5, PRPF5
• NCBI Gene Id: 9879
• Protein Name: Probable ATP-dependent RNA helicase DDX46
• Description of Target: DDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing. This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing.
• Uniprot ID: Q7L014
• Protein Accession #: NP_055644
• Nucleotide Accession #: NM_014829
• Protein Size (# AA): 1031
• Molecular Weight: 117kDa
• Protein Interactions: HUWE1; UBC; RPA3; RPA2; RPA1; PRPF40A; APBB1; SRPK2; LMNA; TPM2; PNLIPRP2; SMIM20; GEMIN5; SF3A3; SRSF11; CUL3; SIRT7; SF3A2; ELAVL1; SUMO2; Sf3a1; TCEA1;