DDX39 Antibody - N-terminal region (ARP36384_T100)

Catalog No: ARP36384_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-DDX39 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateDDX39A is supported by BioGPS gene expression data to be expressed in HepG2

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDX39
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-DDX39A (ARP36384_T100) antibody is Catalog # AAP36384 (Previous Catalog # AAPP08442)
• Sample Type Confirmation:

  DDX39A is supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Pryor,A., et al., (2004) Nucleic Acids Res. 32 (6), 1857-1865
• Publications:

  Majerciak, V., Deng, M. & Zheng, Z.-M. Requirement of UAP56, URH49, RBM15, and OTT3 in the expression of Kaposi sarcoma-associated herpesvirus ORF57. Virology 407, 206-12 (2010). 20828777

Target Info

• Gene Symbol: DDX39A
• Gene Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A
• Alias Symbols: BAT1, DDXL, BAT1L, DDX39, URH49
• NCBI Gene Id: 10212
• Protein Name: ATP-dependent RNA helicase DDX39A
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX39 encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants encoding different isoforms.
• Uniprot ID: O00148
• Protein Accession #: NP_005795
• Nucleotide Accession #: NM_005804
• Protein Size (# AA): 427
• Molecular Weight: 47kDa
• Protein Interactions: SAT1; SARNP; DDX39A; UBC; MDM2; EED; C12orf10; NAGK; SUGT1; AHSA1; SORD; SMS; GSR; PARP1; SRPK2; SOX2; FBXO6; UBD; TERF2IP; TERF2; TERF1; SUMO1; SUMO2; PTK2; Bud13; AI837181; Erh; UBA5; GBAS; ALYREF; BABAM1; EXOSC9; HIPK2; CCL14; DDX39B;