Search Antibody, Protein, and ELISA Kit Solutions

Ddx20 Antibody - C-terminal region (ARP37239_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37239_P050-FITC Conjugated

ARP37239_P050-HRP Conjugated

ARP37239_P050-Biotin Conjugated

Gene Symbol:
Ddx20
Official Gene Full Name:
DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
NCBI Gene Id:
53975
Protein Name:
Probable ATP-dependent RNA helicase DDX20
Swissprot Id:
Q059Z6
Protein Accession #:
NP_059093
Nucleotide Accession #:
NM_017397
Alias Symbols:
GEMIN3, MGC159174, dp103
Replacement Item:
This antibody may replace item sc-135919 from Santa Cruz Biotechnology.
Description of Target:
The function of Ddx20 remains unknown.
Protein Size (# AA):
825
Molecular Weight:
92kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ddx20.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ddx20.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of mouse Ddx20
Predicted Species Reactivity:
Mouse, Rat
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Mouse: 100%; Rat: 86%
Complete computational species homology data:
Anti-Ddx20 (ARP37239_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RRPIPARSRLVMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Etv3; Ncor2; Sin3a; Ncor1; Hdac2;
Blocking Peptide:
For anti-Ddx20 (ARP37239_P050) antibody is Catalog # AAP37239 (Previous Catalog # AAPS06208)
Datasheets/Manuals:
Printable datasheet for anti-Ddx20 (ARP37239_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...