Search Antibody, Protein, and ELISA Kit Solutions

DDX1 Antibody - middle region : FITC (ARP74479_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74479_P050 Unconjugated

ARP74479_P050-HRP Conjugated

ARP74479_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
DDX1, hCG_15914,
Replacement Item:
This antibody may replace item sc-134752 from Santa Cruz Biotechnology.
Description of Target:
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DDX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DDX1.
The immunogen is a synthetic peptide directed towards the middle region of Human DDX1
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DDX1 (ARP74479_P050-FITC) antibody is Catalog # AAP74479
Printable datasheet for anti-DDX1 (ARP74479_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...