Search Antibody, Protein, and ELISA Kit Solutions

DDX1 Antibody - middle region (ARP74479_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP74479_P050-FITC Conjugated

ARP74479_P050-HRP Conjugated

ARP74479_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-134752 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human DDX1
Purification:
Affinity Purified
Peptide Sequence:
Synthetic peptide located within the following region: TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DDX1 (ARP74479_P050) antibody is Catalog # AAP74479
Datasheets/Manuals:
Printable datasheet for anti-DDX1 (ARP74479_P050) antibody
Gene Symbol:
DDX1
Alias Symbols:
DDX1, hCG_15914,
NCBI Gene Id:
1653
Description of Target:
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.
Swissprot Id:
Q92499
Protein Accession #:
NP_004930
Protein Size (# AA):
740
Molecular Weight:
81kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DDX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DDX1.
Protein Interactions:
HUWE1; FUS; SUMO2; SUMO3; STAU1; UBC; SUMO1; NEDD8; Fbxl16; WWOX; ZBTB1; RPA3; RPA2; RPA1; rev; C14orf166; RTCB; RPL26L1; EIF3K; NELFB; EDC4; IGF2BP3; PDCD6; ABCF1; EIF2B2; EIF2B3; YBX3; RPL27; RFC4; RFC2; QARS; YBX1; NMT1; HNRNPM; MRE11A; KRT18; ILF2; HN

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...