DDT Recombinant Protein (Mouse) (OPCA04080)

Catalog No: OPCA04080

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Mus musculus (Mouse)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
• Protein Sequence: PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 2-118 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Cloning of the mouse gene for D-dopachrome tautomerase.Kuriyama T., Fujinaga M., Koda T., Nishihira J.Biochim. Biophys. Acta 1388:506-512(1998)

Target Info

• Gene Symbol: Ddt
• Gene Full Name: D-dopachrome tautomerase
• Alias Symbols: C78655;D-dopachrome decarboxylase;D-dopachrome tautomerase.
• NCBI Gene Id: 13202
• Protein Name: D-dopachrome decarboxylase
• Description of Target: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).
• Uniprot ID: O35215
• Protein Accession #: NP_034157
• Nucleotide Accession #: NM_010027
• Protein Size (# AA): Recombinant
• Molecular Weight: 14.9 kDa