Catalog No: ARP52821_P050
Price: $0.00
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DDIT4L Antibody - middle region (ARP52821_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-DDIT4L (ARP52821_P050) antibody
Product Info
ReferenceCorradetti,M.N., (2005) J. Biol. Chem. 280 (11), 9769-9772
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DDT4L
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: ESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEP
Concentration0.5 mg/ml
Blocking PeptideFor anti-DDIT4L (ARP52821_P050) antibody is Catalog # AAP52821
Gene SymbolDDIT4L
Gene Full NameDNA damage inducible transcript 4 like
Alias SymbolsREDD2, Rtp801L
NCBI Gene Id115265
Protein NameDNA damage-inducible transcript 4-like protein
Uniprot IDQ96D03
Protein Accession #NP_660287
Nucleotide Accession #NM_145244.3
Protein Size (# AA)193
Molecular Weight21 kDa
Protein InteractionsSNRPG; LSM7; CALCOCO2; MORF4L2; PRKAB2;
  1. What is the species homology for "DDIT4L Antibody - middle region (ARP52821_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "DDIT4L Antibody - middle region (ARP52821_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "DDIT4L Antibody - middle region (ARP52821_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "DDIT4L Antibody - middle region (ARP52821_P050)"?

    This target may also be called "REDD2, Rtp801L" in publications.

  5. What is the shipping cost for "DDIT4L Antibody - middle region (ARP52821_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DDIT4L Antibody - middle region (ARP52821_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DDIT4L Antibody - middle region (ARP52821_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DDIT4L Antibody - middle region (ARP52821_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DDIT4L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DDIT4L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DDIT4L"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DDIT4L"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DDIT4L"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DDIT4L"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DDIT4L Antibody - middle region (ARP52821_P050)
Your Rating