Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
ARP41425_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41425_T100-FITC Conjugated

ARP41425_T100-HRP Conjugated

ARP41425_T100-Biotin Conjugated

DDC Antibody - N-terminal region (ARP41425_T100)

Catalog#: ARP41425_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-293287 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DDC
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 92%; Zebrafish: 92%
Complete computational species homology dataAnti-DDC (ARP41425_T100)
Peptide SequenceSynthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-DDC (ARP41425_T100) antibody is Catalog # AAP41425 (Previous Catalog # AAPP24163)
Datasheets/ManualsPrintable datasheet for anti-DDC (ARP41425_T100) antibody
Sample Type Confirmation

DDC is supported by BioGPS gene expression data to be expressed in HepG2

Target ReferenceMa,J.Z., (2005) Hum. Mol. Genet. 14 (12), 1691-1698
Publications

Shimohata, A; Ishihara, K; Hattori, S; Miyamoto, H; Morishita, H; Ornthanalai, G; Raveau, M; Ebrahim, AS; Amano, K; Yamada, K; Sago, H; Akiba, S; Mataga, N; Murphy, NP; Miyakawa, T; Yamakawa, K; Ts1Cje Down syndrome model mice exhibit environmental stimuli-triggered locomotor hyperactivity and sociability concurrent with increased flux through central dopamine and serotonin metabolism. 293, 1-12 (2017). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 28336394

Gene SymbolDDC
Official Gene Full NameDopa decarboxylase (aromatic L-amino acid decarboxylase)
Alias SymbolsAADC
NCBI Gene Id1644
Protein NameAromatic-L-amino-acid decarboxylase
Description of TargetDDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Swissprot IdP20711
Protein Accession #NP_000781
Nucleotide Accession #NM_000790
Protein Size (# AA)480
Molecular Weight53kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DDC.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DDC.
Protein InteractionsATF6; RELA; AR;
Write Your Own Review
You're reviewing:DDC Antibody - N-terminal region (ARP41425_T100)
Your Rating
Aviva HIS tag Deal
Aviva Live Chat
Aviva Tissue Tool
Aviva Travel Grant