Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

DDC Antibody - N-terminal region (ARP41425_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41425_T100-FITC Conjugated

ARP41425_T100-HRP Conjugated

ARP41425_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Dopa decarboxylase (aromatic L-amino acid decarboxylase)
NCBI Gene Id:
Protein Name:
Aromatic-L-amino-acid decarboxylase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-293287 from Santa Cruz Biotechnology.
Description of Target:
DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DDC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DDC.
The immunogen is a synthetic peptide directed towards the N terminal region of human DDC
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 92%; Zebrafish: 92%
Complete computational species homology data:
Anti-DDC (ARP41425_T100)
Peptide Sequence:
Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DDC (ARP41425_T100) antibody is Catalog # AAP41425 (Previous Catalog # AAPP24163)
Printable datasheet for anti-DDC (ARP41425_T100) antibody
Sample Type Confirmation:

DDC is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Ma,J.Z., (2005) Hum. Mol. Genet. 14 (12), 1691-1698

Shimohata, A; Ishihara, K; Hattori, S; Miyamoto, H; Morishita, H; Ornthanalai, G; Raveau, M; Ebrahim, AS; Amano, K; Yamada, K; Sago, H; Akiba, S; Mataga, N; Murphy, NP; Miyakawa, T; Yamakawa, K; Ts1Cje Down syndrome model mice exhibit environmental stimuli-triggered locomotor hyperactivity and sociability concurrent with increased flux through central dopamine and serotonin metabolism. 293, 1-12 (2017). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 28336394

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...