Size:100 ul
$289.00
In Stock
SKU
ARP73816_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP73816_P050 Unconjugated

ARP73816_P050-HRP Conjugated

ARP73816_P050-Biotin Conjugated

DDB1 Antibody - middle region : FITC (ARP73816_P050-FITC)

Catalog#: ARP73816_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-116206 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human DDB1
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: IGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEV
Concentration0.5 mg/ml
Blocking PeptideFor anti-DDB1 (ARP73816_P050-FITC) antibody is Catalog # AAP73816
Datasheets/ManualsPrintable datasheet for anti-DDB1 (ARP73816_P050-FITC) antibody
Gene SymbolDDB1
Alias SymbolsDDB1, XAP1,
NCBI Gene Id1642
Description of TargetThe protein encoded by this gene is the large subunit (p127) of the heterodimeric DNA damage-binding (DDB) complex while another protein (p48) forms the small subunit. This protein complex functions in nucleotide-excision repair and binds to DNA following UV damage. Defective activity of this complex causes the repair defect in patients with xeroderma pigmentosum complementation group E (XPE) - an autosomal recessive disorder characterized by photosensitivity and early onset of carcinomas. However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients. The protein encoded by this gene also functions as an adaptor molecule for the cullin 4 (CUL4) ubiquitin E3 ligase complex by facilitating the binding of substrates to this complex and the ubiquitination of proteins.
Swissprot IdQ16531
Protein Accession #XP_005273861
Protein Size (# AA)1140
Molecular Weight125kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DDB1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DDB1.
Protein InteractionsSAP30; DCAF5; CUL4B; HUWE1; DCAF15; DCAF17; SAP130; DDA1; SUDS3; DCAF6; AMBRA1; DET1; PHIP; DCAF16; ARID4B; DTL; DCAF4; SIN3A; DCAF12; WDTC1; RBP1; HDAC2; HDAC1; ERCC8; UBC; CEP72; vpr; HCVgp1; CRBN; CEP57; AURKB; RFWD2; CEP250; TUBGCP2; CHEK1; CDKN1A; TP
Write Your Own Review
You're reviewing:DDB1 Antibody - middle region : FITC (ARP73816_P050-FITC)
Your Rating
Aviva HIS tag Deal
Aviva Tissue Tool
Aviva Validation Data
Aviva Live Chat