Search Antibody, Protein, and ELISA Kit Solutions

DDB1 Antibody - middle region : FITC (ARP73816_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73816_P050 Unconjugated

ARP73816_P050-HRP Conjugated

ARP73816_P050-Biotin Conjugated

Gene Symbol:
DDB1
NCBI Gene Id:
1642
Swissprot Id:
Q16531
Protein Accession #:
XP_005273861
Alias Symbols:
DDB1, XAP1,
Replacement Item:
This antibody may replace item sc-116206 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is the large subunit (p127) of the heterodimeric DNA damage-binding (DDB) complex while another protein (p48) forms the small subunit. This protein complex functions in nucleotide-excision repair and binds to DNA following UV damage. Defective activity of this complex causes the repair defect in patients with xeroderma pigmentosum complementation group E (XPE) - an autosomal recessive disorder characterized by photosensitivity and early onset of carcinomas. However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients. The protein encoded by this gene also functions as an adaptor molecule for the cullin 4 (CUL4) ubiquitin E3 ligase complex by facilitating the binding of substrates to this complex and the ubiquitination of proteins.
Protein Size (# AA):
1140
Molecular Weight:
125kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DDB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DDB1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human DDB1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: IGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
SAP30; DCAF5; CUL4B; HUWE1; DCAF15; DCAF17; SAP130; DDA1; SUDS3; DCAF6; AMBRA1; DET1; PHIP; DCAF16; ARID4B; DTL; DCAF4; SIN3A; DCAF12; WDTC1; RBP1; HDAC2; HDAC1; ERCC8; UBC; CEP72; vpr; HCVgp1; CRBN; CEP57; AURKB; RFWD2; CEP250; TUBGCP2; CHEK1; CDKN1A; TP
Blocking Peptide:
For anti-DDB1 (ARP73816_P050-FITC) antibody is Catalog # AAP73816
Datasheets/Manuals:
Printable datasheet for anti-DDB1 (ARP73816_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...