DDAH1 Antibody - middle region : FITC (ARP54852_P050-FITC)

Catalog No: ARP54852_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Additional Information: IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 2.5 ug/ml.
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDAH1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DDAH1 (ARP54852_P050-FITC) antibody is Catalog # AAP54852 (Previous Catalog # AAPP31656)

Target Info

• Reference: Kim,Y.J., (2008) Twin Res Hum Genet 11 (1), 77-83
• Gene Symbol: DDAH1
• Gene Full Name: Dimethylarginine dimethylaminohydrolase 1
• Alias Symbols: DDAH, DDAHI, DDAH-1, HEL-S-16
• NCBI Gene Id: 23576
• Protein Name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
• Description of Target: DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Sequence Note: AB001915.1 is a chimeric sequence. Only the DDAH1 region was propagated into this RefSeq record. [6/17/03, RefSeq staff]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O94760
• Protein Accession #: NP_036269
• Nucleotide Accession #: NM_012137
• Protein Size (# AA): 285
• Molecular Weight: 31kDa
• Protein Interactions: PSMD10; IQCB1; ELAVL1; CALM1;