Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP81499_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

DCTN1 Antibody - middle region (ARP81499_P050)

Catalog#: ARP81499_P050
Domestic: within 24 hours delivery International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DCTN1
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: PYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DCTN1 (ARP81499_P050) antibody is Catalog # AAP81499
Datasheets/Manuals Printable datasheet for anti-DCTN1 (ARP81499_P050) antibody
Gene Symbol DCTN1
Official Gene Full Name dynactin subunit 1
Alias Symbols P135, DP-150, DAP-150
NCBI Gene Id 1639
Protein Name dynactin subunit 1
Description of Target This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein and binds to microtubules via a highly conserved glycine-rich cytoskeleton-associated protein (CAP-Gly) domain in its N-terminus. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause distal hereditary motor neuronopathy type VIIB (HMN7B) which is also known as distal spinal and bulbar muscular atrophy (dSBMA).
Swissprot Id Q14203
Protein Accession # NP_001128512.1
Nucleotide Accession # NM_001135040.2
Protein Size (# AA) 1278
Molecular Weight 140 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DCTN1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DCTN1.
Write Your Own Review
You're reviewing:DCTN1 Antibody - middle region (ARP81499_P050)
Your Rating