Search Antibody, Protein, and ELISA Kit Solutions

DCTN1 Antibody - middle region (ARP81499_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
DCTN1
Official Gene Full Name:
dynactin subunit 1
NCBI Gene Id:
1639
Protein Name:
dynactin subunit 1
Swissprot Id:
Q14203
Protein Accession #:
NP_001128512.1
Nucleotide Accession #:
NM_001135040.2
Alias Symbols:
P135, DP-150, DAP-150
Description of Target:
This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein and binds to microtubules via a highly conserved glycine-rich cytoskeleton-associated protein (CAP-Gly) domain in its N-terminus. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause distal hereditary motor neuronopathy type VIIB (HMN7B) which is also known as distal spinal and bulbar muscular atrophy (dSBMA).
Protein Size (# AA):
1278
Molecular Weight:
140 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DCTN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DCTN1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DCTN1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DCTN1 (ARP81499_P050) antibody is Catalog # AAP81499
Datasheets/Manuals:
Printable datasheet for anti-DCTN1 (ARP81499_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...