Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP43421_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43421_P050-FITC Conjugated

ARP43421_P050-HRP Conjugated

ARP43421_P050-Biotin Conjugated

DCST1 Antibody - C-terminal region (ARP43421_P050)

Catalog#: ARP43421_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-103452 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DCST1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Rabbit: 93%; Rat: 85%
Complete computational species homology data Anti-DCST1 (ARP43421_P050)
Peptide Sequence Synthetic peptide located within the following region: SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DCST1 (ARP43421_P050) antibody is Catalog # AAP43421 (Previous Catalog # AAPP25204)
Datasheets/Manuals Printable datasheet for anti-DCST1 (ARP43421_P050) antibody
Target Reference Isogai,T., Unpublished (2001)
Publications

Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat 22030471

Gene Symbol DCST1
Official Gene Full Name DC-STAMP domain containing 1
Alias Symbols FLJ32785, RP11-307C12.10
NCBI Gene Id 149095
Protein Name DC-STAMP domain-containing protein 1
Description of Target The function remains unknown.
Swissprot Id Q5T197
Protein Accession # NP_689707
Nucleotide Accession # NM_152494
Protein Size (# AA) 706
Molecular Weight 78kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DCST1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DCST1.
Protein Interactions NEDD1; CUL4A;
Write Your Own Review
You're reviewing:DCST1 Antibody - C-terminal region (ARP43421_P050)
Your Rating