Search Antibody, Protein, and ELISA Kit Solutions

DCST1 Antibody - C-terminal region (ARP43421_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43421_P050-FITC Conjugated

ARP43421_P050-HRP Conjugated

ARP43421_P050-Biotin Conjugated

Gene Symbol:
DCST1
Official Gene Full Name:
DC-STAMP domain containing 1
NCBI Gene Id:
149095
Protein Name:
DC-STAMP domain-containing protein 1
Swissprot Id:
Q5T197
Protein Accession #:
NP_689707
Nucleotide Accession #:
NM_152494
Alias Symbols:
FLJ32785, RP11-307C12.10
Replacement Item:
This antibody may replace item sc-103452 from Santa Cruz Biotechnology.
Description of Target:
The function remains unknown.
Protein Size (# AA):
706
Molecular Weight:
78kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DCST1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DCST1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human DCST1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Rabbit: 93%; Rat: 85%
Complete computational species homology data:
Anti-DCST1 (ARP43421_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NEDD1; CUL4A;
Blocking Peptide:
For anti-DCST1 (ARP43421_P050) antibody is Catalog # AAP43421 (Previous Catalog # AAPP25204)
Datasheets/Manuals:
Printable datasheet for anti-DCST1 (ARP43421_P050) antibody
Target Reference:
Isogai,T., Unpublished (2001)
Publications:

Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat 22030471

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...