Search Antibody, Protein, and ELISA Kit Solutions

DCST1 antibody - C-terminal region (ARP43421_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43421_P050-FITC Conjugated

ARP43421_P050-HRP Conjugated

ARP43421_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
DC-STAMP domain containing 1
Protein Name:
DC-STAMP domain-containing protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ32785, RP11-307C12.10
Replacement Item:
This antibody may replace item sc-103452 from Santa Cruz Biotechnology.
Description of Target:
The function remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DCST1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DCST1.
The immunogen is a synthetic peptide directed towards the C terminal region of human DCST1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Rabbit: 93%; Rat: 85%
Complete computational species homology data:
Anti-DCST1 (ARP43421_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DCST1 (ARP43421_P050) antibody is Catalog # AAP43421 (Previous Catalog # AAPP25204)
Printable datasheet for anti-DCST1 (ARP43421_P050) antibody
Target Reference:
Isogai,T., Unpublished (2001)

Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat 22030471

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...