SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP51164_P050
Price: $0.00
SKU
ARP51164_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DCLRE1C (ARP51164_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DCLRE1C
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL
Concentration0.5 mg/ml
Blocking PeptideFor anti-DCLRE1C (ARP51164_P050) antibody is Catalog # AAP51164 (Previous Catalog # AAPP28035)
Sample Type Confirmation

DCLRE1C is supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceBethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276
Gene SymbolDCLRE1C
Gene Full NameDNA cross-link repair 1C
Alias SymbolsSCIDA, SNM1C, A-SCID, RS-SCID, DCLREC1C
NCBI Gene Id64421
Protein NameProtein artemis
Description of TargetDCLRE1C is a nuclear protein that is involved in V(D)J recombination and DNA repair. The protein has single-strand-specific 5'-3' exonuclease activity; it also exhibits endonuclease activity on 5' and 3' overhangs and hairpins when complexed with protein kinase, DNA-activated, catalytic polypeptide. Mutations in this gene cause Athabascan-type severe combined immunodeficiency (SCIDA).This gene encodes a nuclear protein that is involved in V(D)J recombination and DNA repair. The protein has single-strand-specific 5'-3' exonuclease activity; it also exhibits endonuclease activity on 5' and 3' overhangs and hairpins when complexed with protein kinase, DNA-activated, catalytic polypeptide. Mutations in this gene cause Athabascan-type severe combined immunodeficiency (SCIDA).
Uniprot IDQ96SD1
Protein Accession #NP_001029027
Nucleotide Accession #NM_001033855
Protein Size (# AA)692
Molecular Weight78kDa
Protein InteractionsXRCC5; PRKDC; RAD50; NBN; MRE11A; BRCA1; ATR; ATM; PSMD9; DDB2; DDB1; FBXW7; TP53BP1;
  1. What is the species homology for "DCLRE1C Antibody - N-terminal region (ARP51164_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "DCLRE1C Antibody - N-terminal region (ARP51164_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DCLRE1C Antibody - N-terminal region (ARP51164_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DCLRE1C Antibody - N-terminal region (ARP51164_P050)"?

    This target may also be called "SCIDA, SNM1C, A-SCID, RS-SCID, DCLREC1C" in publications.

  5. What is the shipping cost for "DCLRE1C Antibody - N-terminal region (ARP51164_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DCLRE1C Antibody - N-terminal region (ARP51164_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DCLRE1C Antibody - N-terminal region (ARP51164_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "78kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DCLRE1C Antibody - N-terminal region (ARP51164_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DCLRE1C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DCLRE1C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DCLRE1C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DCLRE1C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DCLRE1C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DCLRE1C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DCLRE1C Antibody - N-terminal region (ARP51164_P050)
Your Rating
We found other products you might like!