Protein on Demand™ DCK Recombinant Protein (Rat) (OPCA17305)

Datasheets/Manuals	Printable datasheet for OPCA17305

Product Info
Predicted Species Reactivity	Rat
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MATPPKRFCSSPSTSSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCNVQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFIFQSYACLSRIRAQLASLNGSLRDAEKPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRATPEKCLNRIYIRGRDEEQGIPLEYLEKLHYKHESWLLHRTLKTNFEYLQEVPILTLDVNLDFKDKEESLVEKVKEFLSTT
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-260

Gene Full Name	deoxycytidine kinase
NCBI Gene Id	79127
Protein Name	deoxycytidine kinase
Description of Target	kinase that phosphorylates several deoxyribonucleosides and their nucleoside analogs [RGD, Feb 2006]
Uniprot ID	P48769
Protein Accession #	NP_077072.1
Nucleotide Accession #	NM_024158.1
Protein Size (# AA)	260