- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for DCK Antibody (OAAL00069) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 2F10 |
| Isotype | IgG2b Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | DCK (NP_000779, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | DCK |
|---|---|
| Gene Full Name | deoxycytidine kinase |
| Alias Symbols | deoxyadenosine kinase;deoxycytidine kinase;deoxyguanosine kinase;deoxynucleoside kinase. |
| NCBI Gene Id | 1633 |
| Protein Name | deoxycytidine kinase [Homo sapiens]|Homo sapiens deoxycytidine kinase (DCK), mRNA |
| Description of Target | Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_000779 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_000788 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "DCK Antibody (OAAL00069)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "DCK Antibody (OAAL00069)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "DCK Antibody (OAAL00069)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "DCK Antibody (OAAL00069)"?
This target may also be called "deoxyadenosine kinase;deoxycytidine kinase;deoxyguanosine kinase;deoxynucleoside kinase." in publications.
-
What is the shipping cost for "DCK Antibody (OAAL00069)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "DCK Antibody (OAAL00069)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "DCK Antibody (OAAL00069)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "DCK Antibody (OAAL00069)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "DCK"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "DCK"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "DCK"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "DCK"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "DCK"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "DCK"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
