Search Antibody, Protein, and ELISA Kit Solutions

DCK antibody - middle region (ARP51775_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51775_P050-FITC Conjugated

ARP51775_P050-HRP Conjugated

ARP51775_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Deoxycytidine kinase
Protein Name:
Deoxycytidine kinase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC117410, MGC138632
Replacement Item:
This antibody may replace item sc-393098 from Santa Cruz Biotechnology.
Description of Target:
Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity.Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DCK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DCK.
The immunogen is a synthetic peptide directed towards the middle region of human DCK
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
Complete computational species homology data:
Anti-DCK (ARP51775_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DCK (ARP51775_P050) antibody is Catalog # AAP51775 (Previous Catalog # AAPY03509)
Printable datasheet for anti-DCK (ARP51775_P050) antibody
Target Reference:
Iyidogan,P. (2008) Biochemistry 47 (16), 4711-4720

Bieghs, L. et al. The effects of forodesine in murine and human multiple myeloma cells. Adv. Hematol. 2010, 131895 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20981156

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...