Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP51775_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51775_P050-FITC Conjugated

ARP51775_P050-HRP Conjugated

ARP51775_P050-Biotin Conjugated

DCK Antibody - middle region (ARP51775_P050)

Catalog#: ARP51775_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-393098 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DCK
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
Complete computational species homology data Anti-DCK (ARP51775_P050)
Peptide Sequence Synthetic peptide located within the following region: ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DCK (ARP51775_P050) antibody is Catalog # AAP51775 (Previous Catalog # AAPY03509)
Datasheets/Manuals Printable datasheet for anti-DCK (ARP51775_P050) antibody
Target Reference Iyidogan,P. (2008) Biochemistry 47 (16), 4711-4720
Publications

Bieghs, L. et al. The effects of forodesine in murine and human multiple myeloma cells. Adv. Hematol. 2010, 131895 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20981156

Gene Symbol DCK
Official Gene Full Name Deoxycytidine kinase
Alias Symbols MGC117410, MGC138632
NCBI Gene Id 1633
Protein Name Deoxycytidine kinase
Description of Target Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity.Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P27707
Protein Accession # NP_000779
Nucleotide Accession # NM_000788
Protein Size (# AA) 260
Molecular Weight 30kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DCK.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DCK.
Protein Interactions UBC; EFHD2; CHRAC1; CHMP4A; CBX3; TYMS; THOP1; TALDO1; RBBP7; RANBP1; PTMS; IDH1; HSPE1; ADSS; TFEC; ELAVL1; RXRG; DCK; MED19; GOLM1; DDX19B;
Write Your Own Review
You're reviewing:DCK Antibody - middle region (ARP51775_P050)
Your Rating