Search Antibody, Protein, and ELISA Kit Solutions

DCC Antibody - middle region : FITC (ARP46583_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46583_P050 Unconjugated

ARP46583_P050-HRP Conjugated

ARP46583_P050-Biotin Conjugated

Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
DCC
Official Gene Full Name:
Deleted in colorectal carcinoma
NCBI Gene Id:
1630
Protein Name:
Netrin receptor DCC
Swissprot Id:
P43146
Protein Accession #:
NP_005206
Nucleotide Accession #:
NM_005215
Alias Symbols:
CRC18, CRCR1, IGDCC1
Replacement Item:
This antibody may replace item sc-11437 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma.
Protein Size (# AA):
1447
Molecular Weight:
158kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DCC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DCC.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DCC
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-DCC (ARP46583_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ
Concentration:
0.5 mg/ml
Protein Interactions:
UBC; ALB; BARD1; sina; UBI4; SIAH2; EIF4E3; EIF2A; EIF5A2; NTN1; RPL23; EIF2S2; EIF2B2; EIF2B4; EZR; RPS24; RPS13; RPS10; RPS6; RPS4X; RPL38; RPL28; RPL13; RPL5; PTK2; MAPK1; RPL10A; EIF3E; EIF4E; EIF2S3; EIF2B1; EIF1AX; ADORA2B; APPL1; CASP9; SIAH1; MAPK
Blocking Peptide:
For anti-DCC (ARP46583_P050-FITC) antibody is Catalog # AAP46583 (Previous Catalog # AAPS19506)
Datasheets/Manuals:
Printable datasheet for anti-DCC (ARP46583_P050-FITC) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...