Search Antibody, Protein, and ELISA Kit Solutions

DCC Antibody - middle region (ARP46583_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP46583_P050-FITC Conjugated

ARP46583_P050-HRP Conjugated

ARP46583_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Deleted in colorectal carcinoma
NCBI Gene Id:
Protein Name:
Netrin receptor DCC
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-11437 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DCC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DCC.
The immunogen is a synthetic peptide directed towards the middle region of human DCC
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-DCC (ARP46583_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DCC (ARP46583_P050) antibody is Catalog # AAP46583 (Previous Catalog # AAPS19506)
Printable datasheet for anti-DCC (ARP46583_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...