Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OAAF08030
Size:100 ug
Price: $344.00
SKU
OAAF08030
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for DBI Antibody (OAAF08030)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
Product FormatLiquid PBS (without Mg2+ and Ca2+) pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol
ClonalityPolyclonal
IsotypeIgG
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Western blot
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from the C-terminal region of human DBI.
PurificationThe antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Peptide SequenceSynthetic peptide located within the following region: GDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Concentration1 mg/ml
SpecificityDBI Antibody detects endogenous levels of DBI protein.
Application InfoWB: 1:500~1000
ELISA: 1:10000
Gene SymbolDBI
Gene Full Namediazepam binding inhibitor, acyl-CoA binding protein
Alias SymbolsACBD1;ACBP;acyl coenzyme A binding protein;acyl-CoA-binding protein;acyl-Coenzyme A binding domain containing 1;CCK-RP;cholecystokinin-releasing peptide, trypsin-sensitive;diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein);diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein);diazepam-binding inhibitor;endozepine;EP;epididymis secretory sperm binding protein;GABA receptor modulator.
NCBI Gene Id1622
Protein NameAcyl-CoA-binding protein
Description of TargetBinds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Uniprot IDP07108
Molecular Weight10 kDa
  1. What is the species homology for "DBI Antibody (OAAF08030)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "DBI Antibody (OAAF08030)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "DBI Antibody (OAAF08030)" provided in?

    This item is provided in "Liquid PBS (without Mg2+ and Ca2+) pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DBI Antibody (OAAF08030)"?

    This target may also be called "ACBD1;ACBP;acyl coenzyme A binding protein;acyl-CoA-binding protein;acyl-Coenzyme A binding domain containing 1;CCK-RP;cholecystokinin-releasing peptide, trypsin-sensitive;diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein);diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein);diazepam-binding inhibitor;endozepine;EP;epididymis secretory sperm binding protein;GABA receptor modulator." in publications.

  5. What is the shipping cost for "DBI Antibody (OAAF08030)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DBI Antibody (OAAF08030)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DBI Antibody (OAAF08030)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "10 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DBI Antibody (OAAF08030)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DBI"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DBI"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DBI"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DBI"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DBI"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DBI"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DBI Antibody (OAAF08030)
Your Rating
We found other products you might like!