DAZL Antibody - C-terminal region (ARP40355_P050)

Catalog No: ARP40355_P050

Host: Rabbit
Target Name: DAZL
Sample Type: Stomach tumor lysates
Antibody Dilution: 1.0ug/ml

Host: Mouse
Target Name: DAZL
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DAZL
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DAZL (ARP40355_P050) antibody is Catalog # AAP40355

Target Info

• Gene Symbol: DAZL
• Gene Full Name: deleted in azoospermia-like
• Alias Symbols: DAZH, DAZL1, DAZLA, SPGYLA
• NCBI Gene Id: 1618
• Protein Name: Deleted in azoospermia-like
• Description of Target: DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. DAZL is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of the autosomal gene encoding DAZL during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in the Dazl gene have been linked to severe spermatogenic failure and infertility in males.
• Uniprot ID: Q92904
• Protein Accession #: NP_001342
• Nucleotide Accession #: NM_001351
• Protein Size (# AA): 295
• Molecular Weight: 32kDa
• Protein Interactions: PUM2; DAZ1; UBC; DAZ4; DAZL; DAZAP2; DAZAP1;