DAZAP1 Antibody - middle region (ARP40925_P050)

Catalog No: ARP40925_P050

WB Suggested Anti-DAZAP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateDAZAP1 is supported by BioGPS gene expression data to be expressed in Jurkat

Rabbit Anti-DAZAP1 antibody
Catalog Number: ARP40925
Paraffin Embedded Tissue: Human Heart
cell Cellular Data: cardiac cell
Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DAZAP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: GKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DAZAP1 (ARP40925_P050) antibody is Catalog # AAP40925 (Previous Catalog # AAPP22893)
• Sample Type Confirmation:

  DAZAP1 is supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Goina,E., (2008) Mol. Cell. Biol. 28 (11), 3850-3860

Target Info

• Gene Symbol: DAZAP1
• Gene Full Name: DAZ associated protein 1
• Alias Symbols: MGC19907
• NCBI Gene Id: 26528
• Protein Name: DAZ-associated protein 1
• Description of Target: In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. DAZAP1 is a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.
• Uniprot ID: Q96EP5
• Protein Accession #: NP_061832
• Nucleotide Accession #: NM_018959
• Protein Size (# AA): 401
• Molecular Weight: 43kDa
• Protein Interactions: UBC; WWOX; RPA3; RPA2; RPA1; SUZ12; RNF2; EZH2; BMI1; rev; ITCH; RAD52; VCAM1; ITGA4; FN1; BRCA1; CAND1; COPS5; CUL1; CUL2; CUL3; CUL4B; CUL5; NEDD8; ELAVL1; SUMO2; DAZ1; DAZL;