Search Antibody, Protein, and ELISA Kit Solutions

DAZAP1 Antibody - C-terminal region (ARP41161_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP41161_P050-FITC Conjugated

ARP41161_P050-HRP Conjugated

ARP41161_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-119662 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the C terminal region of human DAZAP1
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-DAZAP1 (ARP41161_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QAAPDMSKPPTAQPDFPYGQYGLGSYSPAPPGCGPHFVYSLMVRLSSDVA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DAZAP1 (ARP41161_P050) antibody is Catalog # AAP41161 (Previous Catalog # AAPP22536)
Printable datasheet for anti-DAZAP1 (ARP41161_P050) antibody
Sample Type Confirmation:

DAZAP1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Pan,H.A., Fertil. Steril. 84 SUPPL 2, 1089-1094 (2005)

Hayakawa, H. et al. Human proteins that specifically bind to 8-oxoguanine-containing RNA and their responses to oxidative stress. Biochem. Biophys. Res. Commun. 403, 220-4 (2010). IHC, WB, Human 21073862

Gene Symbol:
Official Gene Full Name:
DAZ associated protein 1
Alias Symbols:
NCBI Gene Id:
Protein Name:
DAZ-associated protein 1
Description of Target:
In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. DAZAP1 is a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL.In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DAZAP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DAZAP1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...