Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP41161_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41161_P050-FITC Conjugated

ARP41161_P050-HRP Conjugated

ARP41161_P050-Biotin Conjugated

DAZAP1 Antibody - C-terminal region (ARP41161_P050)

Catalog#: ARP41161_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-119662 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DAZAP1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-DAZAP1 (ARP41161_P050)
Peptide Sequence Synthetic peptide located within the following region: QAAPDMSKPPTAQPDFPYGQYGLGSYSPAPPGCGPHFVYSLMVRLSSDVA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DAZAP1 (ARP41161_P050) antibody is Catalog # AAP41161 (Previous Catalog # AAPP22536)
Datasheets/Manuals Printable datasheet for anti-DAZAP1 (ARP41161_P050) antibody
Sample Type Confirmation

DAZAP1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Pan,H.A., Fertil. Steril. 84 SUPPL 2, 1089-1094 (2005)
Publications

Hayakawa, H. et al. Human proteins that specifically bind to 8-oxoguanine-containing RNA and their responses to oxidative stress. Biochem. Biophys. Res. Commun. 403, 220-4 (2010). IHC, WB, Human 21073862

Gene Symbol DAZAP1
Official Gene Full Name DAZ associated protein 1
Alias Symbols MGC19907
NCBI Gene Id 26528
Protein Name DAZ-associated protein 1
Description of Target In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. DAZAP1 is a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL.In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.
Swissprot Id Q96EP5-2
Protein Accession # NP_733829
Nucleotide Accession # NM_170711
Protein Size (# AA) 378
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DAZAP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DAZAP1.
Protein Interactions UBC; WWOX; RPA3; RPA2; RPA1; SUZ12; RNF2; EZH2; BMI1; rev; ITCH; RAD52; VCAM1; ITGA4; FN1; BRCA1; CAND1; COPS5; CUL1; CUL2; CUL3; CUL4B; CUL5; NEDD8; ELAVL1; SUMO2; DAZ1; DAZL;
  1. What is the species homology for "DAZAP1 Antibody - C-terminal region (ARP41161_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "DAZAP1 Antibody - C-terminal region (ARP41161_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DAZAP1 Antibody - C-terminal region (ARP41161_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DAZAP1 Antibody - C-terminal region (ARP41161_P050)"?

    This target may also be called "MGC19907" in publications.

  5. What is the shipping cost for "DAZAP1 Antibody - C-terminal region (ARP41161_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DAZAP1 Antibody - C-terminal region (ARP41161_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DAZAP1 Antibody - C-terminal region (ARP41161_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DAZAP1 Antibody - C-terminal region (ARP41161_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DAZAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DAZAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DAZAP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DAZAP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DAZAP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DAZAP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DAZAP1 Antibody - C-terminal region (ARP41161_P050)
Your Rating
We found other products you might like!