SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP40924_T100
Price: $0.00
SKU
ARP40924_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DAZAP1 (ARP40924_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human DAZAP1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 93%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: LAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQP
Concentration1.0 mg/ml
Blocking PeptideFor anti-DAZAP1 (ARP40924_T100) antibody is Catalog # AAP40924 (Previous Catalog # AAPP22892)
Sample Type Confirmation

DAZAP1 is supported by BioGPS gene expression data to be expressed in Daudi

ReferencePan,H.A., Fertil. Steril. 84 SUPPL 2, 1089-1094 (2005)
Gene SymbolDAZAP1
Gene Full NameDAZ associated protein 1
NCBI Gene Id26528
Protein NameDAZ-associated protein 1
Description of TargetIn mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. DAZAP1 is a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL.In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.
Uniprot IDQ96EP5
Protein Accession #NP_061832
Nucleotide Accession #NM_018959
Protein Size (# AA)407
Molecular Weight45kDa
Protein InteractionsUBC; WWOX; RPA3; RPA2; RPA1; SUZ12; RNF2; EZH2; BMI1; rev; ITCH; RAD52; VCAM1; ITGA4; FN1; BRCA1; CAND1; COPS5; CUL1; CUL2; CUL3; CUL4B; CUL5; NEDD8; ELAVL1; SUMO2; DAZ1; DAZL;
  1. What is the species homology for "DAZAP1 Antibody - C-terminal region (ARP40924_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "DAZAP1 Antibody - C-terminal region (ARP40924_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DAZAP1 Antibody - C-terminal region (ARP40924_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DAZAP1 Antibody - C-terminal region (ARP40924_T100)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "DAZAP1 Antibody - C-terminal region (ARP40924_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DAZAP1 Antibody - C-terminal region (ARP40924_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DAZAP1 Antibody - C-terminal region (ARP40924_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DAZAP1 Antibody - C-terminal region (ARP40924_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DAZAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DAZAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DAZAP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DAZAP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DAZAP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DAZAP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DAZAP1 Antibody - C-terminal region (ARP40924_T100)
Your Rating
We found other products you might like!