Catalog No: ARP58711_P050
Price: $0.00
SKU
ARP58711_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DAZ1 (ARP58711_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DAZ1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 85%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR
Concentration0.5 mg/ml
Blocking PeptideFor anti-DAZ1 (ARP58711_P050) antibody is Catalog # AAP58711 (Previous Catalog # AAPP35911)
ReferenceStouffs,K., (2008) Hum. Reprod. 23 (5), 1193-1199
Gene SymbolDAZ1
Gene Full NameDeleted in azoospermia 1
Alias SymbolsDAZ, SPGY
NCBI Gene Id1617
Protein NameDeleted in azoospermia protein 1
Description of TargetDAZ1 is a RNA-binding protein that plays an essential role in spermatogenesis. DAZ1 may act by binding to the 3'-UTR of mRNAs and regulating their translation.This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains three copies of the 10.8 kb repeat. However, no transcripts containing three copies of the RRM domain have been described; thus the RefSeq for this gene contains only two RRM domains. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ9NQZ3
Protein Accession #NP_004072
Nucleotide Accession #NM_004081
Protein Size (# AA)579
Molecular Weight64kDa
Protein InteractionsDZIP1L; BOLL; PUM2; DZIP1; QKI; DAZL; UBC; DAZ1; DZIP3; DAZAP2; DAZAP1; DYNLL1;
  1. What is the species homology for "DAZ1 Antibody - N-terminal region (ARP58711_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit".

  2. How long will it take to receive "DAZ1 Antibody - N-terminal region (ARP58711_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DAZ1 Antibody - N-terminal region (ARP58711_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DAZ1 Antibody - N-terminal region (ARP58711_P050)"?

    This target may also be called "DAZ, SPGY" in publications.

  5. What is the shipping cost for "DAZ1 Antibody - N-terminal region (ARP58711_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DAZ1 Antibody - N-terminal region (ARP58711_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DAZ1 Antibody - N-terminal region (ARP58711_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "64kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DAZ1 Antibody - N-terminal region (ARP58711_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DAZ1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DAZ1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DAZ1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DAZ1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DAZ1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DAZ1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DAZ1 Antibody - N-terminal region (ARP58711_P050)
Your Rating