Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

DAZ1 Antibody - N-terminal region (ARP58711_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58711_P050-FITC Conjugated

ARP58711_P050-HRP Conjugated

ARP58711_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Deleted in azoospermia 1
NCBI Gene Id:
Protein Name:
Deleted in azoospermia protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-100705 from Santa Cruz Biotechnology.
Description of Target:
DAZ1 is a RNA-binding protein that plays an essential role in spermatogenesis. DAZ1 may act by binding to the 3'-UTR of mRNAs and regulating their translation.This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains three copies of the 10.8 kb repeat. However, no transcripts containing three copies of the RRM domain have been described; thus the RefSeq for this gene contains only two RRM domains. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DAZ1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DAZ1.
The immunogen is a synthetic peptide directed towards the N terminal region of human DAZ1
Predicted Species Reactivity:
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 85%; Rat: 79%
Complete computational species homology data:
Anti-DAZ1 (ARP58711_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DAZ1 (ARP58711_P050) antibody is Catalog # AAP58711 (Previous Catalog # AAPP35911)
Printable datasheet for anti-DAZ1 (ARP58711_P050) antibody
Target Reference:
Stouffs,K., (2008) Hum. Reprod. 23 (5), 1193-1199

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...