Dag1 Antibody - C-terminal region (ARP46446_P050)

Catalog No: ARP46446_P050

WB Suggested Anti-Dag1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Mouse Heart

Host: Mouse
Target Name: DAG1
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: DAG1
Sample Tissue: Mouse SP2/0 Whole Cell
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: DAG1
Sample Tissue: Mouse Liver
Antibody Dilution: 3ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Dag1 (ARP46446_P050) antibody is Catalog # AAP46446 (Previous Catalog # AAPS18312)

Target Info

• Gene Symbol: Dag1
• Gene Full Name: Dystroglycan 1
• Alias Symbols: DG, Dp71, Dp427, D9Wsu13, D9Wsu13e
• NCBI Gene Id: 13138
• Protein Name: Dystroglycan
• Description of Target: The dystroglycan complex is involved in a number of processes including laminin and basement membrane assembly, sacrolemmal stability, cell survival, peripheral nerve myelination, nodal structure, cell migration, and epithelial polarization.Alpha-dystroglycan is an extracellular peripheral glycoprotein that acts as a receptor for both extracellular matrix proteins containing laminin-G domains, and for certain adenoviruses. Receptor for laminin-2 (LAMA2) and agrin in peripheral nerve Schwann cells. Also receptor for lymphocytic choriomeningitis virus, Old World Lassa fever virus, and clade C New World arenaviruses.Beta-dystroglycan is a transmembrane protein that plays important roles in connecting the extracellular matrix to the cytoskeleton. Acts as a cell adhesion receptor in both muscle and non-muscle tissues. Receptor for both DMD and UTRN and, through these interactions, scaffolds axin to the cytoskeleton. Also functions in cell adhesion-mediated signaling and implicated in cell polarity.
• Uniprot ID: Q62165
• Protein Accession #: NP_034147
• Nucleotide Accession #: NM_010017
• Protein Size (# AA): 893
• Molecular Weight: 97kDa
• Protein Interactions: Dmd; Cav3; Sgcd; Sgcb; Utrn; Snta1; Sgca; Lama1;