Catalog No: ARP50256_P050
Price: $0.00
SKU
ARP50256_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CYTB (ARP50256_P050) antibody
Product Info
Publications

CODAS syndrome is associated with mutations of LONP1, encoding mitochondrial AAA+ Lon protease. Am J Hum Genet. 96, 121-35 (2015). 25574826

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CYTB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CYTB (ARP50256_P050) antibody is Catalog # AAP50256 (Previous Catalog # AAPS29306)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
SPR Affinity Characterization Avivasheild
Gene SymbolCYTB
Gene Full NameCytochrome b
Alias SymbolsMTCYB
NCBI Gene Id4519
Description of TargetCYTB belongs to the cytochrome b family. It is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Uniprot IDP00156
Protein Accession #NP_536855
Protein Size (# AA)378
Molecular Weight42kDa
Protein InteractionsMVP;
  1. What is the species homology for "CYTB Antibody - N-terminal region (ARP50256_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "CYTB Antibody - N-terminal region (ARP50256_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CYTB Antibody - N-terminal region (ARP50256_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CYTB Antibody - N-terminal region (ARP50256_P050)"?

    This target may also be called "MTCYB" in publications.

  5. What is the shipping cost for "CYTB Antibody - N-terminal region (ARP50256_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CYTB Antibody - N-terminal region (ARP50256_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CYTB Antibody - N-terminal region (ARP50256_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CYTB Antibody - N-terminal region (ARP50256_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CYTB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CYTB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CYTB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CYTB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CYTB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CYTB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CYTB Antibody - N-terminal region (ARP50256_P050)
Your Rating
We found other products you might like!