CYP8B1 Antibody - middle region (ARP60138_P050)

Catalog No: ARP60138_P050

WB Suggested Anti-CYP8B1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP8B1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CYP8B1 (ARP60138_P050) antibody is Catalog # AAP60138 (Previous Catalog # AAPP46272)

Target Info

• Gene Symbol: CYP8B1
• Gene Full Name: Cytochrome P450, family 8, subfamily B, polypeptide 1
• Alias Symbols: CP8B, CYP12
• NCBI Gene Id: 1582
• Protein Name: 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
• Description of Target: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7-alpha,12-alpha-dihydroxy-4-cholesten-3-one. The balance between these two steroids determines the relative amounts of cholic acid and chenodeoxycholic acid both of which are secreted in the bile and affect the solubility of cholesterol. This gene is unique among the cytochrome P450 genes in that it is intronless.
• Uniprot ID: Q9UNU6
• Protein Accession #: NP_004382
• Nucleotide Accession #: NM_004391
• Protein Size (# AA): 501
• Molecular Weight: 58kDa
• Protein Interactions: UBC;