Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CYP4F3 antibody - N-terminal region (ARP41823_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP41823_P050-FITC Conjugated

ARP41823_P050-HRP Conjugated

ARP41823_P050-Biotin Conjugated

Gene Symbol:
CYP4F3
NCBI Gene Id:
4051
Official Gene Full Name:
Cytochrome P450, family 4, subfamily F, polypeptide 3
Protein Name:
Leukotriene-B(4) omega-hydroxylase 2
Swissprot Id:
Q08477
Protein Accession #:
NP_000887
Nucleotide Accession #:
NM_000896
Alias Symbols:
CPF3, CYP4F, LTB4H
Replacement Item:
This antibody may replace item sc-105260 from Santa Cruz Biotechnology.
Description of Target:
This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot
Protein Size (# AA):
520
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP4F3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP4F3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CYP4F3
Species Reactivity:
Dog, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Human: 100%; Mouse: 85%; Rat: 85%
Complete computational species homology data:
Anti-CYP4F3 (ARP41823_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-CYP4F3 (ARP41823_P050) antibody is Catalog # AAP41823 (Previous Catalog # AAPP10947)
Datasheets/Manuals:
Printable datasheet for anti-CYP4F3 (ARP41823_P050) antibody
Sample Type Confirmation:

CYP4F3 is supported by BioGPS gene expression data to be expressed in OVCAR3

Target Reference:
Dhar,M., (2008) J. Lipid Res. 49 (3), 612-624

Tell us what you think about this item!

Write A Review
    Please, wait...