Search Antibody, Protein, and ELISA Kit Solutions

CYP4F3 Antibody - N-terminal region (ARP41823_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41823_P050-FITC Conjugated

ARP41823_P050-HRP Conjugated

ARP41823_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Dog, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-105260 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CYP4F3
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Human: 100%; Mouse: 85%; Rat: 85%
Complete computational species homology data:
Anti-CYP4F3 (ARP41823_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CYP4F3 (ARP41823_P050) antibody is Catalog # AAP41823 (Previous Catalog # AAPP10947)
Datasheets/Manuals:
Printable datasheet for anti-CYP4F3 (ARP41823_P050) antibody
Sample Type Confirmation:

CYP4F3 is supported by BioGPS gene expression data to be expressed in OVCAR3

Target Reference:
Dhar,M., (2008) J. Lipid Res. 49 (3), 612-624
Gene Symbol:
CYP4F3
Official Gene Full Name:
Cytochrome P450, family 4, subfamily F, polypeptide 3
Alias Symbols:
CPF3, CYP4F, LTB4H
NCBI Gene Id:
4051
Protein Name:
Leukotriene-B(4) omega-hydroxylase 2
Description of Target:
This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot
Swissprot Id:
Q08477
Protein Accession #:
NP_000887
Nucleotide Accession #:
NM_000896
Protein Size (# AA):
520
Molecular Weight:
60kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP4F3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP4F3.
Protein Interactions:
UBC;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...