Catalog No: ARP63725_P050
Price: $0.00
SKU
ARP63725_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CYP4F2 (ARP63725_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 86%; Goat: 83%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 86%
Complete computational species homology dataAnti-CYP4F2 (ARP63725_P050)
Peptide SequenceSynthetic peptide located within the following region: QAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CYP4F2 (ARP63725_P050) antibody is Catalog # AAP63725
Sample Type Confirmation

CYP4F2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Gene SymbolCYP4F2
Gene Full NameCytochrome P450, family 4, subfamily F, polypeptide 2
Alias SymbolsCPF2
NCBI Gene Id8529
Protein NameLeukotriene-B(4) omega-hydroxylase 1
Description of TargetThis gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F11, is approximately 16 kb away.
Swissprot IdP78329
Protein Accession #NP_001073
Nucleotide Accession #NM_001082
Protein Size (# AA)520
Molecular Weight60 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CYP4F2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CYP4F2.
Protein InteractionsPDR; CYB5A; UBC;
  1. What is the species homology for "CYP4F2 Antibody - C-terminal region (ARP63725_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "CYP4F2 Antibody - C-terminal region (ARP63725_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CYP4F2 Antibody - C-terminal region (ARP63725_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CYP4F2 Antibody - C-terminal region (ARP63725_P050)"?

    This target may also be called "CPF2" in publications.

  5. What is the shipping cost for "CYP4F2 Antibody - C-terminal region (ARP63725_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CYP4F2 Antibody - C-terminal region (ARP63725_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CYP4F2 Antibody - C-terminal region (ARP63725_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CYP4F2 Antibody - C-terminal region (ARP63725_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CYP4F2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CYP4F2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CYP4F2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CYP4F2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CYP4F2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CYP4F2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CYP4F2 Antibody - C-terminal region (ARP63725_P050)
Your Rating
We found other products you might like!