CYP3A7 Antibody - middle region (ARP41801_T100)

Catalog No: ARP41801_T100

WB Suggested Anti-CYP3A7 Antibody Titration: 2.5ug/ml
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 75%; Guinea Pig: 83%; Human: 100%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-CYP3A7 (ARP41801_T100) antibody is Catalog # AAP41801 (Previous Catalog # AAPP10849)
• Reference: Sim,S.C., (2005) Pharmacogenet. Genomics 15 (9), 625-631
• Publications:

  Van Peer, E. et al. Ontogeny of CYP3A and P-glycoprotein in the liver and the small intestine of the Göttingen minipig: an immunohistochemical evaluation. Basic Clin. Pharmacol. Toxicol. 114, 387-94 (2014). 24224644

Target Info

• Gene Symbol: CYP3A7
• Gene Full Name: Cytochrome P450, family 3, subfamily A, polypeptide 7
• Alias Symbols: CP37, CYPIIIA7, P450HLp2, P450-HFLA, P-450111A7, P-450(HFL33)
• NCBI Gene Id: 1551
• Protein Name: Cytochrome P450 3A7
• Description of Target: CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.This gene, CYP3A7, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Transcript variants have been described, but it is not known whether these transcripts are normally produced.
• Uniprot ID: P24462
• Protein Accession #: NP_000756
• Nucleotide Accession #: NM_000765
• Protein Size (# AA): 503
• Molecular Weight: 57kDa