Size:100 ul
$229.00
In stock
SKU
ARP41801_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41801_T100-FITC Conjugated

ARP41801_T100-HRP Conjugated

ARP41801_T100-Biotin Conjugated

CYP3A7 Antibody - middle region (ARP41801_T100)

Catalog#: ARP41801_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133492 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 75%; Guinea Pig: 83%; Human: 100%; Rat: 85%
Complete computational species homology data Anti-CYP3A7 (ARP41801_T100)
Peptide Sequence Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CYP3A7 (ARP41801_T100) antibody is Catalog # AAP41801 (Previous Catalog # AAPP10849)
Datasheets/Manuals Printable datasheet for anti-CYP3A7 (ARP41801_T100) antibody
Target Reference Sim,S.C., (2005) Pharmacogenet. Genomics 15 (9), 625-631
Publications

Van Peer, E. et al. Ontogeny of CYP3A and P-glycoprotein in the liver and the small intestine of the Göttingen minipig: an immunohistochemical evaluation. Basic Clin. Pharmacol. Toxicol. 114, 387-94 (2014). WB, Cow, Dog, Guinea Pig, Human, Rat 24224644

Gene Symbol CYP3A7
Official Gene Full Name Cytochrome P450, family 3, subfamily A, polypeptide 7
Alias Symbols CP37, P450-HFLA, CYPIIIA7
NCBI Gene Id 1551
Protein Name Cytochrome P450 3A7
Description of Target CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.This gene, CYP3A7, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Transcript variants have been described, but it is not known whether these transcripts are normally produced.
Swissprot Id P24462
Protein Accession # NP_000756
Nucleotide Accession # NM_000765
Protein Size (# AA) 503
Molecular Weight 57kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CYP3A7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CYP3A7.
Write Your Own Review
You're reviewing:CYP3A7 Antibody - middle region (ARP41801_T100)
Your Rating