Size:100 ul
$229.00
In Stock
SKU
ARP41801_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41801_T100-FITC Conjugated

ARP41801_T100-HRP Conjugated

ARP41801_T100-Biotin Conjugated

CYP3A7 Antibody - middle region (ARP41801_T100)

Catalog#: ARP41801_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133492 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 75%; Guinea Pig: 83%; Human: 100%; Rat: 85%
Complete computational species homology data Anti-CYP3A7 (ARP41801_T100)
Peptide Sequence Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CYP3A7 (ARP41801_T100) antibody is Catalog # AAP41801 (Previous Catalog # AAPP10849)
Datasheets/Manuals Printable datasheet for anti-CYP3A7 (ARP41801_T100) antibody
Target Reference Sim,S.C., (2005) Pharmacogenet. Genomics 15 (9), 625-631
Publications

Van Peer, E. et al. Ontogeny of CYP3A and P-glycoprotein in the liver and the small intestine of the Göttingen minipig: an immunohistochemical evaluation. Basic Clin. Pharmacol. Toxicol. 114, 387-94 (2014). WB, Cow, Dog, Guinea Pig, Human, Rat 24224644

Gene Symbol CYP3A7
Official Gene Full Name Cytochrome P450, family 3, subfamily A, polypeptide 7
Alias Symbols CP37, P450-HFLA, CYPIIIA7
NCBI Gene Id 1551
Protein Name Cytochrome P450 3A7
Description of Target CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.This gene, CYP3A7, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Transcript variants have been described, but it is not known whether these transcripts are normally produced.
Swissprot Id P24462
Protein Accession # NP_000756
Nucleotide Accession # NM_000765
Protein Size (# AA) 503
Molecular Weight 57kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CYP3A7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CYP3A7.
  1. What is the species homology for "CYP3A7 Antibody - middle region (ARP41801_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Rat".

  2. How long will it take to receive "CYP3A7 Antibody - middle region (ARP41801_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CYP3A7 Antibody - middle region (ARP41801_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CYP3A7 Antibody - middle region (ARP41801_T100)"?

    This target may also be called "CP37, P450-HFLA, CYPIIIA7" in publications.

  5. What is the shipping cost for "CYP3A7 Antibody - middle region (ARP41801_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CYP3A7 Antibody - middle region (ARP41801_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CYP3A7 Antibody - middle region (ARP41801_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CYP3A7 Antibody - middle region (ARP41801_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CYP3A7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CYP3A7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CYP3A7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CYP3A7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CYP3A7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CYP3A7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CYP3A7 Antibody - middle region (ARP41801_T100)
Your Rating
We found other products you might like!