Search Antibody, Protein, and ELISA Kit Solutions

CYP3A7 Antibody - middle region (ARP41801_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41801_T100-FITC Conjugated

ARP41801_T100-HRP Conjugated

ARP41801_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Cytochrome P450, family 3, subfamily A, polypeptide 7
NCBI Gene Id:
Protein Name:
Cytochrome P450 3A7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133492 from Santa Cruz Biotechnology.
Description of Target:
CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.This gene, CYP3A7, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Transcript variants have been described, but it is not known whether these transcripts are normally produced.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP3A7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP3A7.
The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Dog: 75%; Guinea Pig: 83%; Human: 100%; Rat: 85%
Complete computational species homology data:
Anti-CYP3A7 (ARP41801_T100)
Peptide Sequence:
Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CYP3A7 (ARP41801_T100) antibody is Catalog # AAP41801 (Previous Catalog # AAPP10849)
Printable datasheet for anti-CYP3A7 (ARP41801_T100) antibody
Target Reference:
Sim,S.C., (2005) Pharmacogenet. Genomics 15 (9), 625-631

Van Peer, E. et al. Ontogeny of CYP3A and P-glycoprotein in the liver and the small intestine of the Göttingen minipig: an immunohistochemical evaluation. Basic Clin. Pharmacol. Toxicol. 114, 387-94 (2014). WB, Cow, Dog, Guinea Pig, Human, Rat 24224644

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...