CYP3A5 Antibody - N-terminal region (ARP60135_P050)

Catalog No: ARP60135_P050

WB Suggested Anti-CYP3A5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta

Rabbit Anti-CYP3A5 antibody
Catalog Number: ARP60135
Formalin Fixed Paraffin Embedded Tissue: Human Adult Small intestine
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CYP3A5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 91%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 82%; Pig: 93%; Rat: 79%; Sheep: 79%
• Peptide Sequence: Synthetic peptide located within the following region: AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CYP3A5 (ARP60135_P050) antibody is Catalog # AAP60135 (Previous Catalog # AAPP46269)

Target Info

• Gene Symbol: CYP3A5
• Gene Full Name: Cytochrome P450, family 3, subfamily A, polypeptide 5
• Alias Symbols: CP35, PCN3, CYPIIIA5, P450PCN3
• NCBI Gene Id: 1577
• Protein Name: Cytochrome P450 2J2
• Description of Target: This gene,CYP3A5, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. The enzyme metabolizes drugs such as nifedipine and cyclosporine as well as the steroid hormones testosterone, progesterone and androstenedione. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. This cluster includes a pseudogene, CYP3A5P1, which is very similar to CYP3A5. This similarity has caused some difficulty in determining whether cloned sequences represent the gene or the pseudogene. Multiple alternatively spliced transcript variants have been identified for this gene.
• Uniprot ID: P51589
• Protein Accession #: NP_000768
• Nucleotide Accession #: NM_000777
• Protein Size (# AA): 502
• Molecular Weight: 57kDa
• Protein Interactions: RDH13; ATOH8; ETV5;