- Gene Symbol:
- CYP3A43
- NCBI Gene Id:
- 64816
- Official Gene Full Name:
- Cytochrome P450, family 3, subfamily A, polypeptide 43
- Protein Name:
- Cytochrome P450 3A43
- Swissprot Id:
- Q9HB55
- Protein Accession #:
- NP_073731
- Nucleotide Accession #:
- NM_022820
- Alias Symbols:
- MGC119315, MGC119316
- Replacement Item:
- This antibody may replace item sc-30612 from Santa Cruz Biotechnology.
- Description of Target:
- CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms.
- Protein Size (# AA):
- 504
- Molecular Weight:
- 58kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB, IHC
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express CYP3A43.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express CYP3A43.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C terminal region of human CYP3A43
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 92%; Dog: 86%; Goat: 85%; Guinea Pig: 80%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 92%; Rabbit: 85%; Rat: 92%; Sheep: 92%
- Complete computational species homology data:
- Anti-CYP3A43 (ARP49758_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-CYP3A43 (ARP49758_P050) antibody is Catalog # AAP49758 (Previous Catalog # AAPS26712)
- Datasheets/Manuals:
- Printable datasheet for anti-CYP3A43 (ARP49758_P050) antibody
- Target Reference:
- Thompson,E.E., (2006) Pharmacogenomics J. 6 (2), 105-114
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
