Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CYP3A4 antibody - middle region (ARP51349_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP51349_P050-FITC Conjugated

ARP51349_P050-HRP Conjugated

ARP51349_P050-Biotin Conjugated

Gene Symbol:
CYP3A4
NCBI Gene Id:
1576
Official Gene Full Name:
Cytochrome P450, family 3, subfamily A, polypeptide 4
Protein Name:
Cytochrome P450 3A4
Swissprot Id:
P08684
Protein Accession #:
NP_059488
Nucleotide Accession #:
NM_017460
Alias Symbols:
CP33, CP34, CYP3A, CYP3A3, HLP, MGC126680, NF-25, P450C3, P450PCN1, CYPIIIA3, CYPIIIA4
Replacement Item:
This antibody may replace item sc-25845 from Santa Cruz Biotechnology.
Description of Target:
This gene, CYP3A4, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot
Protein Size (# AA):
503
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP3A4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP3A4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CYP3A4
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 85%; Goat: 86%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Sheep: 86%
Complete computational species homology data:
Anti-CYP3A4 (ARP51349_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; PRKCA; PRKACA; PGRMC1; POR; GK; CYB5A; STUB1; AMFR; UGT2B7;
Blocking Peptide:
For anti-CYP3A4 (ARP51349_P050) antibody is Catalog # AAP51349 (Previous Catalog # AAPP28704)
Datasheets/Manuals:
Printable datasheet for anti-CYP3A4 (ARP51349_P050) antibody
Publications:

Werk, A. N. et al. Identification and Characterization of a Defective CYP3A4 Genotype in a Kidney Transplant Patient With Severely Diminished Tacrolimus Clearance. Clin. Pharmacol. Ther. 95, 416-22 (2014). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 24126681

Tell us what you think about this item!

Write A Review
    Please, wait...