Search Antibody, Protein, and ELISA Kit Solutions

CYP3A4 Antibody - middle region (ARP51349_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP51349_P050-FITC Conjugated

ARP51349_P050-HRP Conjugated

ARP51349_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-25845 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CYP3A4
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 85%; Goat: 86%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Sheep: 86%
Complete computational species homology data:
Anti-CYP3A4 (ARP51349_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CYP3A4 (ARP51349_P050) antibody is Catalog # AAP51349 (Previous Catalog # AAPP28704)
Datasheets/Manuals:
Printable datasheet for anti-CYP3A4 (ARP51349_P050) antibody
Publications:

Werk, A. N. et al. Identification and Characterization of a Defective CYP3A4 Genotype in a Kidney Transplant Patient With Severely Diminished Tacrolimus Clearance. Clin. Pharmacol. Ther. 95, 416-22 (2014). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 24126681

Gene Symbol:
CYP3A4
Official Gene Full Name:
Cytochrome P450, family 3, subfamily A, polypeptide 4
Alias Symbols:
CP33, CP34, CYP3A, CYP3A3, HLP, MGC126680, NF-25, P450C3, P450PCN1, CYPIIIA3, CYPIIIA4
NCBI Gene Id:
1576
Protein Name:
Cytochrome P450 3A4
Description of Target:
This gene, CYP3A4, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot
Swissprot Id:
P08684
Protein Accession #:
NP_059488
Nucleotide Accession #:
NM_017460
Protein Size (# AA):
503
Molecular Weight:
57kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP3A4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP3A4.
Protein Interactions:
UBC; PRKCA; PRKACA; PGRMC1; POR; GK; CYB5A; STUB1; AMFR; UGT2B7;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...