Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP51349_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51349_P050-FITC Conjugated

ARP51349_P050-HRP Conjugated

ARP51349_P050-Biotin Conjugated

CYP3A4 Antibody - middle region (ARP51349_P050)

Catalog#: ARP51349_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-25845 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CYP3A4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 85%; Goat: 86%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Sheep: 86%
Complete computational species homology dataAnti-CYP3A4 (ARP51349_P050)
Peptide SequenceSynthetic peptide located within the following region: MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CYP3A4 (ARP51349_P050) antibody is Catalog # AAP51349 (Previous Catalog # AAPP28704)
Datasheets/ManualsPrintable datasheet for anti-CYP3A4 (ARP51349_P050) antibody
Publications

Werk, A. N. et al. Identification and Characterization of a Defective CYP3A4 Genotype in a Kidney Transplant Patient With Severely Diminished Tacrolimus Clearance. Clin. Pharmacol. Ther. 95, 416-22 (2014). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 24126681

Gene SymbolCYP3A4
Official Gene Full NameCytochrome P450, family 3, subfamily A, polypeptide 4
Alias SymbolsCP33, CP34, CYP3A, CYP3A3, HLP, MGC126680, NF-25, P450C3, P450PCN1, CYPIIIA3, CYPIIIA4
NCBI Gene Id1576
Protein NameCytochrome P450 3A4
Description of TargetThis gene, CYP3A4, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot
Swissprot IdP08684
Protein Accession #NP_059488
Nucleotide Accession #NM_017460
Protein Size (# AA)503
Molecular Weight57kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CYP3A4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CYP3A4.
Protein InteractionsUBC; PRKCA; PRKACA; PGRMC1; POR; GK; CYB5A; STUB1; AMFR; UGT2B7;
Write Your Own Review
You're reviewing:CYP3A4 Antibody - middle region (ARP51349_P050)
Your Rating
Aviva Validation Data
Aviva ChIP Antibodies
Aviva Pathways
Aviva Travel Grant