Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP97917_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

CYP2B6 Antibody - middle region (ARP97917_P050)

Catalog#: ARP97917_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CYP2B6
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: DLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CYP2B6 (ARP97917_P050) antibody is Catalog # AAP97917
Datasheets/Manuals Printable datasheet for anti-CYP2B6 (ARP97917_P050) antibody
Gene Symbol CYP2B6
Official Gene Full Name cytochrome P450 family 2 subfamily B member 6
Alias Symbols CPB6, EFVM, IIB1, P450, CYP2B, CYP2B7, CYP2B7P, CYPIIB6
NCBI Gene Id 1555
Protein Name cytochrome P450 2B6
Description of Target This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize some xenobiotics, such as the anti-cancer drugs cyclophosphamide and ifosphamide. Transcript variants for this gene have been described; however, it has not been resolved whether these transcripts are in fact produced by this gene or by a closely related pseudogene, CYP2B7. Both the gene and the pseudogene are located in the middle of a CYP2A pseudogene found in a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
Swissprot Id P20813
Protein Accession # NP_000758.1
Nucleotide Accession # NM_000767.4
Protein Size (# AA) 491
Molecular Weight 56 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CYP2B6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CYP2B6.
  1. What is the species homology for "CYP2B6 Antibody - middle region (ARP97917_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CYP2B6 Antibody - middle region (ARP97917_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "CYP2B6 Antibody - middle region (ARP97917_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CYP2B6 Antibody - middle region (ARP97917_P050)"?

    This target may also be called "CPB6, EFVM, IIB1, P450, CYP2B, CYP2B7, CYP2B7P, CYPIIB6" in publications.

  5. What is the shipping cost for "CYP2B6 Antibody - middle region (ARP97917_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CYP2B6 Antibody - middle region (ARP97917_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CYP2B6 Antibody - middle region (ARP97917_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CYP2B6 Antibody - middle region (ARP97917_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CYP2B6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CYP2B6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CYP2B6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CYP2B6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CYP2B6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CYP2B6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CYP2B6 Antibody - middle region (ARP97917_P050)
Your Rating