Search Antibody, Protein, and ELISA Kit Solutions

CYP2B6 Antibody - middle region (ARP97917_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CYP2B6
Official Gene Full Name:
cytochrome P450 family 2 subfamily B member 6
NCBI Gene Id:
1555
Protein Name:
cytochrome P450 2B6
Swissprot Id:
P20813
Protein Accession #:
NP_000758.1
Nucleotide Accession #:
NM_000767.4
Alias Symbols:
CPB6, EFVM, IIB1, P450, CYP2B, CYP2B7, CYP2B7P, CYPIIB6
Description of Target:
This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize some xenobiotics, such as the anti-cancer drugs cyclophosphamide and ifosphamide. Transcript variants for this gene have been described; however, it has not been resolved whether these transcripts are in fact produced by this gene or by a closely related pseudogene, CYP2B7. Both the gene and the pseudogene are located in the middle of a CYP2A pseudogene found in a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
Protein Size (# AA):
491
Molecular Weight:
56 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP2B6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP2B6.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CYP2B6
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CYP2B6 (ARP97917_P050) antibody is Catalog # AAP97917
Datasheets/Manuals:
Printable datasheet for anti-CYP2B6 (ARP97917_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...