CYP2A6 Antibody - C-terminal region (ARP60126_P050)

Catalog No: ARP60126_P050

WB Suggested Anti-CYP2A6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2A6
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 83%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CYP2A6 (ARP60126_P050) antibody is Catalog # AAP60126 (Previous Catalog # AAPP46261)

Target Info

• Gene Symbol: CYP2A6
• Gene Full Name: Cytochrome P450, family 2, subfamily A, polypeptide 6
• Alias Symbols: CPA6, CYP2A, CYP2A3, P450PB, CYPIIA6, P450C2A
• NCBI Gene Id: 1548
• Protein Name: Cytochrome P450 2A6
• Description of Target: CYP2A6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to hydroxylate coumarin, and also metabolizes nicotine, aflatoxin B1, nitrosamines, and some pharmaceuticals. Individuals with certain allelic variants are said to have a poor metabolizer phenotype, meaning they do not efficiently metabolize coumarin or nicotine. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. The gene was formerly referred to as CYP2A3; however, it has been renamed CYP2A6.
• Uniprot ID: P11509
• Protein Accession #: NP_000753
• Nucleotide Accession #: NM_000762
• Protein Size (# AA): 494
• Molecular Weight: 56kDa
• Protein Interactions: POR; CYB5A;