CYP27A1 Antibody - middle region (ARP51773_P050)

Catalog No: ARP51773_P050

WB Suggested Anti-CYP27A1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP27A1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CYP27A1 (ARP51773_P050) antibody is Catalog # AAP51773 (Previous Catalog # AAPY03507)
• Reference: Szlago,M., (2008) Neurology 70 (5), 402-404

Target Info

• Gene Symbol: CYP27A1
• Gene Full Name: Cytochrome P450, family 27, subfamily A, polypeptide 1
• Alias Symbols: CTX, CP27, CYP27
• NCBI Gene Id: 1593
• Protein Name: Sterol 26-hydroxylase, mitochondrial
• Description of Target: CYP27A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q02318
• Protein Accession #: NP_000775
• Nucleotide Accession #: NM_000784
• Protein Size (# AA): 531
• Molecular Weight: 57kDa
• Protein Interactions: PRDX4;