SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP60147_P050
Price: $0.00
SKU
ARP60147_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CYP24A1 Antibody - C-terminal region (ARP60147_P050)

Rating:
100% of 100
Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-CYP24A1 (ARP60147_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC, IHC-P, IHC-FFPE
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CYP24A1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: LNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLS
Concentration0.5 mg/ml
Blocking PeptideFor anti-CYP24A1 (ARP60147_P050) antibody is Catalog # AAP60147 (Previous Catalog # AAPP46280)
Gene SymbolCYP24A1
Gene Full NameCytochrome P450, family 24, subfamily A, polypeptide 1
Alias SymbolsCP24, HCAI, CYP24, HCINF1, P450-CC24
NCBI Gene Id1591
Protein Name1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
Description of TargetCYP24A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system.
Uniprot IDQ07973
Protein Accession #NP_000773
Nucleotide Accession #NM_000782
Protein Size (# AA)514
Molecular Weight55kDa
Protein InteractionsDlg4; UBC;
  1. What is the species homology for "CYP24A1 Antibody - C-terminal region (ARP60147_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CYP24A1 Antibody - C-terminal region (ARP60147_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CYP24A1 Antibody - C-terminal region (ARP60147_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CYP24A1 Antibody - C-terminal region (ARP60147_P050)"?

    This target may also be called "CP24, HCAI, CYP24, HCINF1, P450-CC24" in publications.

  5. What is the shipping cost for "CYP24A1 Antibody - C-terminal region (ARP60147_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CYP24A1 Antibody - C-terminal region (ARP60147_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CYP24A1 Antibody - C-terminal region (ARP60147_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CYP24A1 Antibody - C-terminal region (ARP60147_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CYP24A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CYP24A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CYP24A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CYP24A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CYP24A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CYP24A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CYP24A1 Antibody - C-terminal region (ARP60147_P050)
Your Rating
We found other products you might like!