Search Antibody, Protein, and ELISA Kit Solutions

CYP1B1 Antibody - middle region (ARP51761_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51761_P050-FITC Conjugated

ARP51761_P050-HRP Conjugated

ARP51761_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Cytochrome P450, family 1, subfamily B, polypeptide 1
NCBI Gene Id:
Protein Name:
Cytochrome P450 1B1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CP1B, GLC3A, P4501B1, CYPIB1
Replacement Item:
This antibody may replace item sc-133490 from Santa Cruz Biotechnology.
Description of Target:
CYP1B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP1B1 localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP1B1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP1B1.
The immunogen is a synthetic peptide directed towards the middle region of human CYP1B1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-CYP1B1 (ARP51761_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CYP1B1 (ARP51761_P050) antibody is Catalog # AAP51761 (Previous Catalog # AAPP40136)
Printable datasheet for anti-CYP1B1 (ARP51761_P050) antibody

Staršíchová, A. et al. TGF-b1 signaling plays a dominant role in the crosstalk between TGF-b1 and the aryl hydrocarbon receptor ligand in prostate epithelial cells. Cell. Signal. 24, 1665-76 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22560882

Wang, X., Hawkins, B. T. & Miller, D. S. Aryl hydrocarbon receptor-mediated up-regulation of ATP-driven xenobiotic efflux transporters at the blood-brain barrier. FASEB J. 25, 644-52 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21048045

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: CYP1B1 antibody-middle region (ARP51761_P050) in Human and mouse lung microsome lysate using Western Blot
Product Page for CYP1B1 antibody-middle region (ARP51761_P050)_x000D_ _x000D_ Researcher: Jing Peng, Fox Chase Cancer Center_x000D_ Application: Western blotting_x000D_ Species + Tissue/Cell type: Human and mouse lung microsome lysate_x000D_ How many ug's of tissue/cell lysate run on the gel:_x000D_ 1: Human lung microsome lysate_x000D_ 2: 150 ug mouse lung microsome lysate_x000D_ 3: 150 ug mouse lung microsome lysate_x000D_ 4: 150 ug mouse lung microsome lysate_x000D_ 5: 150 ug mouse lung microsome lysate_x000D_ Primary antibody dilution: 1: 1000_x000D_ Secondary antibody: Anti-rabbit HRP_x000D_ Secondary antibody dilution: 1: 10000_x000D_ _x000D_ _x000D_ _x000D_ Questionnaire:_x000D_ _x000D_ How do Aviva's reagents play a role in your experimental goals?_x000D_ We have data on gene expression at RNA levels and we would like to perform western blot to examine the protein levels. Therefore, we are testing those antibodies from Aviva for that goal._x000D_ _x000D_ How would you rate this antibody on a scale from 1-5 (5=best) and why?_x000D_ 3._x000D_ _x000D_ Would you use this antibody in future experiments?_x000D_ Yes._x000D_ _x000D_ Have you used another antibody which has worked in your application?_x000D_ No._x000D_ _x000D_ Do you believe the information about the reagent on Aviva's website is correct?_x000D_ Yes._x000D_ _x000D_ If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?_x000D_ Yes. If the ab works, we plan to use it in future experiments and will publish the data if the experiments work._x000D_ _x000D_ How did you store the antibody after re-suspension?_x000D_ 10ul aliquots in -20oC._x000D_ _x000D_ Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):_x000D_ Isolated Microsome: Mouse Lung Tissue._x000D_ _x000D_ How many different experimental trials were conducted using the antibody sample?_x000D_ 2._x000D_ _x000D_ How was this sample prepared?_x000D_ Microsome isolated from mouse lung tissue processed by mechanical homogenizer._x000D_ _x000D_ What controls were used in your experiment (positive/negative)?_x000D_ Positive control : human lung microsome._x000D_ _x000D_ Please include your detailed WB Procedure/Protocol here:_x000D_ Microsome isolated in KCL buffer + protease inhibitors_x000D_ SDS PAGE: Used Bio-Rad ready gel 12%. Electrophoresis for 1 hr at 120V/._x000D_ Electroblotting 2hrs at 120 Volt/_x000D_ Block membrane in 5% milk in TBS-T_x000D_ Primary Antibody 1:1000 (diluted in 5%milk in TBS-T)_x000D_ Incubated overnight in 4o C on a shaker_x000D_ Secondary Antibody 1:10000 incubated for 1 hr RT on a shaker_x000D_ Hose radish solution: ECL plus_x000D_ Chemiluminescence. Protein simple FlourChemE_x000D_ _x000D_
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...