Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP51761_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51761_P050-FITC Conjugated

ARP51761_P050-HRP Conjugated

ARP51761_P050-Biotin Conjugated

CYP1B1 Antibody - middle region (ARP51761_P050)

Rating:
60% of 100
Catalog#: ARP51761_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-133490 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CYP1B1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-CYP1B1 (ARP51761_P050)
Peptide SequenceSynthetic peptide located within the following region: AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CYP1B1 (ARP51761_P050) antibody is Catalog # AAP51761 (Previous Catalog # AAPP40136)
Datasheets/ManualsPrintable datasheet for anti-CYP1B1 (ARP51761_P050) antibody
Publications

Staršíchová, A. et al. TGF-b1 signaling plays a dominant role in the crosstalk between TGF-b1 and the aryl hydrocarbon receptor ligand in prostate epithelial cells. Cell. Signal. 24, 1665-76 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22560882

Wang, X., Hawkins, B. T. & Miller, D. S. Aryl hydrocarbon receptor-mediated up-regulation of ATP-driven xenobiotic efflux transporters at the blood-brain barrier. FASEB J. 25, 644-52 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21048045

Gene SymbolCYP1B1
Official Gene Full NameCytochrome P450, family 1, subfamily B, polypeptide 1
Alias SymbolsCP1B, GLC3A, P4501B1, CYPIB1
NCBI Gene Id1545
Protein NameCytochrome P450 1B1
Description of TargetCYP1B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP1B1 localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdQ16678
Protein Accession #NP_000095
Nucleotide Accession #NM_000104
Protein Size (# AA)543
Molecular Weight61kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CYP1B1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CYP1B1.
Protein InteractionsUBC; SAE1;
Write Your Own Review
You're reviewing:CYP1B1 Antibody - middle region (ARP51761_P050)
Your Rating
Aviva HIS tag Deal
Aviva ChIP Antibodies
Aviva Pathways
Aviva Travel Grant