Search Antibody, Protein, and ELISA Kit Solutions

CYP1A1 antibody - middle region (ARP41404_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41404_P050-FITC Conjugated

ARP41404_P050-HRP Conjugated

ARP41404_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Cytochrome P450, family 1, subfamily A, polypeptide 1
Protein Name:
Cytochrome P450 1A1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AHH, AHRR, CP11, CYP1, P1-450, P450-C, P450DX
Replacement Item:
This antibody may replace item sc-101828 from Santa Cruz Biotechnology.
Description of Target:
CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP1A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP1A1.
The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-CYP1A1 (ARP41404_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CYP1A1 (ARP41404_P050) antibody is Catalog # AAP41404 (Previous Catalog # AAPP24142)
Printable datasheet for anti-CYP1A1 (ARP41404_P050) antibody
Target Reference:
Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...